KEGG   Homo sapiens (human): 65985
Entry
65985             CDS       T01001                                 

Gene name
AACS, ACSF1, SUR-5
Definition
(RefSeq) acetoacetyl-CoA synthetase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    65985 (AACS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    65985 (AACS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    65985 (AACS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     65985 (AACS)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   65985 (AACS)
SSDB
Motif
Pfam: AMP-binding ACAS_N
Other DBs
NCBI-GeneID: 65985
NCBI-ProteinID: NP_076417
OMIM: 614364
HGNC: 21298
Ensembl: ENSG00000081760
Vega: OTTHUMG00000168550
Pharos: Q86V21(Tbio)
UniProt: Q86V21 A0A024RBV2
LinkDB
Position
12q24.31
AA seq 672 aa
MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSD
FWAEFWKFSGIVFSRVYDEVVDTSKGIADVPEWFKGSRLNYAENLLRHKENDRVALYIAR
EGKEEIVKVTFEELRQEVALFAAAMRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIW
SSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVIP
YVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAAMVLYDGSPLV
PTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHSLQMLHTILSTGSPLKAQSYE
YVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWG
ESGELVCTKPIPCQPTHFWNDENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIVMLGRS
DGTLNPNGVRFGSSEIYNIVESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLV
KRIRDAIRMGLSARHVPSLILETKGIPYTLNGKKVEVAVKQIIAGKAVEQGGAFSNPETL
DLYRDIPELQGF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgtccaaggaggagcgccccggtcgggaggagatcctggagtgccaggtgatgtgggag
cctgacagtaagaagaacacgcagatggaccgcttccgggcggctgtgggcgccgcctgc
ggcctggcgctggagagttatgatgacttgtaccattggtccgttgagtcatattcagac
ttctgggcagagttctggaaattcagtggaattgtcttctcacgtgtgtatgatgaggtt
gtggacacatcgaaaggaatcgcagatgtccccgagtggttcaaaggcagtcggctcaac
tatgcagaaaacctcctgcggcacaaagagaatgacagagttgccctttacattgcaagg
gaaggcaaagaggaaattgtgaaggtgacttttgaagagctgaggcaagaagtggctttg
tttgcagcagcaatgaggaaaatgggtgtgaagaaaggagatcgggttgttggttattta
cccaacagtgagcacgctgtcgaggcgatgctggctgcggcaagcattggtgccatctgg
agctccacgtccccggacttcggtgtgaatggtgtgctggaccggttttctcaaattcag
ccaaagctcatcttctctgtggaggctgttgtctataatggcaaagagcacaaccacatg
gaaaagctgcagcaggtggttaaaggcctaccagacttgaagaaagtggtggtgattcct
tatgtgtcctccagagagaacatagacctttcaaagattccaaacagtgtgtttctggat
gactttcttgccaccggcaccagtgagcaggccccgcagctggagttcgagcagctgccc
ttcagccacccactgttcatcatgttctcatcgggcaccacgggcgcacccaagtgcatg
gtgcattccgctgggggcaccctcatccagcatctgaaggagcacctgctgcacggcaac
atgaccagcagtgacatcctcctgtgctacaccacggtcggctggatgatgtggaactgg
atggtgtcccttctggccacaggagcggccatggtcttgtacgatggctcccccctggtg
cccacgcccaatgtgctctgggacctggttgacaggataggcatcactgtcctggtaact
ggggccaagtggctgtcagtgctggaagagaaggccatgaagccggtggaaacccacagt
ctccagatgctccacacgatcctgtccactggctccccactgaaagcccagagctacgag
tatgtctacaggtgcatcaagagcagcatcctcctgggctccatctcaggaggcaccgac
atcatctcctgcttcatgggccacaatttttctcttcctgtgtataaaggggagattcag
gcccggaacctgggcatggccgtggaagcgtggaacgaggaaggaaaggcggtctgggga
gagagcggcgagctggtgtgtactaagccgatcccttgccagcccacacacttctggaac
gatgagaacggcaacaagtacaggaaggcgtatttctccaaattcccaggtatctgggct
catggcgactactgcagaatcaaccccaagaccgggggcatcgtcatgcttggccggagt
gacggcaccctcaaccccaacggggtgcggttcggcagctcggaaatctataacattgtg
gaatccttcgaggaggtggaggacagcctgtgtgtcccccagtataacaagtacagggag
gagagggtgatcctcttcctgaagatggcctccgggcacgccttccagcctgacttggtt
aagaggatccgtgacgccatccgcatgggcttgtctgcgcgacacgtgcccagcctcatc
ctggaaaccaagggcatcccgtatacgctcaacggcaagaaagtggaagttgccgtcaaa
cagatcatcgctggaaaagccgtggagcaaggaggtgctttctcgaaccccgagaccctg
gatctgtaccgggacatccctgagctgcagggcttctga

DBGET integrated database retrieval system