KEGG   Homo sapiens (human): 6786Help
Entry
6786              CDS       T01001                                 

Gene name
STIM1, D11S4896E, GOK, IMD10, STRMK, TAM, TAM1
Definition
(RefSeq) stromal interaction molecule 1
  KO
K16059  stromal interaction molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04611  Platelet activation
Disease
H00093  Combined immunodeficiency
H02258  Tubular aggregate myopathy
H02259  Stormorken syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    6786 (STIM1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6786 (STIM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6786 (STIM1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   6786 (STIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOAR SAM_2 SAM_1 SAM_Ste50p Prominin
Motif
Other DBs
NCBI-GeneID: 6786
NCBI-ProteinID: NP_003147
OMIM: 605921
HGNC: 11386
Ensembl: ENSG00000167323
Vega: OTTHUMG00000133360
Pharos: Q13586(Tbio)
UniProt: Q13586
LinkDB All DBs
Structure
PDB: 

Position
11p15.4
AA seq 685 aa AA seqDB search
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatgtatgcgtccgtcttgccctgtggctcctctggggactcctcctgcaccagggc
cagagcctcagccatagtcacagtgagaaggcgacaggaaccagctcgggggccaactct
gaggagtccactgcagcagagttttgccgaattgacaagcccctgtgtcacagtgaggat
gagaaactcagcttcgaggcagtccgtaacatccacaaactgatggacgatgatgccaat
ggtgatgtggatgtggaagaaagtgatgagttcctgagggaagacctcaattaccatgac
ccaacagtgaaacacagcaccttccatggtgaggataagctcatcagcgtggaggacctg
tggaaggcatggaagtcatcagaagtatacaattggaccgtggatgaggtggtacagtgg
ctgatcacatatgtggagctgcctcagtatgaggagaccttccggaagctgcagctcagt
ggccatgccatgccaaggctggctgtcaccaacaccaccatgacagggactgtgctgaag
atgacagaccggagtcatcggcagaagctgcagctgaaggctctggatacagtgctcttt
gggcctcctctcttgactcgccataatcacctcaaggacttcatgctggtggtgtctatc
gttattggtgtgggcggctgctggtttgcctatatccagaaccgttactccaaggagcac
atgaagaagatgatgaaggacttggaggggttacaccgagctgagcagagtctgcatgac
cttcaggaaaggctgcacaaggcccaggaggagcaccgcacagtggaggtggagaaggtc
catctggaaaagaagctgcgcgatgagatcaaccttgctaagcaggaagcccagcggctg
aaggagctgcgggagggtactgagaatgagcggagccgccaaaaatatgctgaggaggag
ttggagcaggttcgggaggccttgaggaaagcagagaaggagctagaatctcacagctca
tggtatgctccagaggcccttcagaagtggctgcagctgacacatgaggtggaggtgcaa
tattacaacatcaagaagcaaaatgctgagaagcagctgctggtggccaaggagggggct
gagaagataaaaaagaagagaaacacactctttggcaccttccacgtggcccacagctct
tccctggatgatgtagatcataaaattctaacagctaagcaagcactgagcgaggtgaca
gcagcattgcgggagcgcctgcaccgctggcaacagatcgagatcctctgtggcttccag
attgtcaacaaccctggcatccactcactggtggctgccctcaacatagaccccagctgg
atgggcagtacacgccccaaccctgctcacttcatcatgactgacgacgtggatgacatg
gatgaggagattgtgtctcccttgtccatgcagtcccctagcctgcagagcagtgttcgg
cagcgcctgacggagccacagcatggcctgggatctcagagggatttgacccattccgat
tcggagtcctccctccacatgagtgaccgccagcgtgtggcccccaaacctcctcagatg
agccgtgctgcagacgaggctctcaatgccatgacttccaatggcagccaccggctgatc
gagggggtccacccagggtctctggtggagaaactgcctgacagccctgccctggccaag
aaggcattactggcgctgaaccatgggctggacaaggcccacagcctgatggagctgagc
ccctcagccccacctggtggctctccacatttggattcttcccgttctcacagccccagc
tccccagacccagacacaccatctccagttggggacagccgagccctgcaagccagccga
aacacacgcattccccacctggctggcaagaaggctgtggctgaggaggataatggctct
attggcgaggaaacagactccagcccaggccggaagaagtttcccctcaaaatctttaag
aagcctcttaagaagtag

DBGET integrated database retrieval system