KEGG   Homo sapiens (human): 6874
Entry
6874              CDS       T01001                                 

Gene name
TAF4, TAF(II)130, TAF(II)135, TAF2C, TAF2C1, TAF4A, TAFII-130, TAFII-135, TAFII130, TAFII135
Definition
(RefSeq) TATA-box binding protein associated factor 4
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05016  Huntington disease
Network
nt06440  Transcription
nt06461  Huntington disease
  Element
N00981  Mutation-caused aberrant Htt to CREB-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6874 (TAF4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    6874 (TAF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6874 (TAF4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6874 (TAF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6874 (TAF4)
   Coactivators
    SAGA/TFTC/STAGA complex
     6874 (TAF4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6874 (TAF4)
SSDB
Motif
Pfam: TAF4 TAFH tRNA-synt_1c
Other DBs
NCBI-GeneID: 6874
NCBI-ProteinID: NP_003176
OMIM: 601796
HGNC: 11537
Ensembl: ENSG00000130699
Vega: OTTHUMG00000032893
Pharos: O00268(Tbio)
UniProt: O00268
LinkDB
Structure
PDB: 

Position
20q13.33
AA seq 1085 aa
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQT
LAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATT
SGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATL
QRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRS
LPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTP
QQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK
NT seq 3258 nt   +upstreamnt  +downstreamnt
atggcggcgggctcggatctgctggacgaggtcttcttcaacagcgaggtggacgagaaa
gtggtgagcgacctggtgggctcgctggagtcgcagctggcggccagcgcggcccaccac
caccacctcgcgccgcgcacgcccgaggtgcgggccgcggccgccggcgcgctcgggaac
catgttgtgagcggcagcccggccggagccgcgggcgcagggccggccgcccccgccgag
ggcgcgcccggagcggcgccggagccgccccccgcaggtagagcgcggccggggggcggg
gggccgcagcgcccgggccccccctcaccgcgccgcccccttgtccccgcagggcccgcg
ccgcccgccgcgaagctgaggccgccgcccgagggcagcgcggggtcctgcgccccggtg
cccgccgccgccgccgtcgccgcggggcccgagcccgcccccgccggccccgccaagccc
gccggccccgccgcgctggccgcccgcgccggccccggccccgggcccggccccggcccc
ggccccggccctggccctggcaagcccgccggccccggcgccgcgcaaactttgaatggg
agcgccgcgctgctgaactcgcaccacgccgccgcacctgctgtcagcctggtcaacaac
gggcccgccgcgctgctgccgctgcccaagcccgccgcccccggcactgtcatccagacg
ccccccttcgtgggcgccgccgcgccccccgcgcccgccgcgccctcgccccccgccgcc
cccgcgcccgccgcccccgccgccgccccgcccccgccaccccccgcgcccgccactctg
gcccggccgcccggccaccccgccggacccccgaccgccgcgcccgccgtgccgcccccc
gccgccgcccagaacgggggcagcgccggggcagcccccgcccccgccccggccgccggg
ggccccgcgggggtcagcggccaacccgggcccggcgcggcggctgcggcgccggcgccg
ggggtcaaggccgagtcgcccaagagggtggtgcaggcggcgcccccggcggcgcagacc
ctggcggccagcggcccggccagcacggcggccagcatggtcatcgggccaactatgcaa
ggggcgctgcccagcccggccgccgtcccgccgcccgcccccgggacccccaccgggctg
cccaaaggcgcggccggcgcagtgacccagagcctgtcccggacgcccacggccaccacc
agcgggattcgggccaccctgacgcccaccgtgctggccccccgcttgccgcagccgcct
cagaacccgaccaacatccagaacttccagctgcccccaggaatggtcctcgtccgaagt
gagaatgggcagttgttaatgattcctcagcaggccttggcccagatgcaggcgcaggcc
catgcccagcctcagaccaccatggcgcctcgccctgccacccccacaagtgcccctccc
gtccagatctccaccgtacaggcacctggaacacctatcattgcacggcaggtgacccca
actaccataattaagcaagtgtctcaggcccagacaacggtgcagcccagtgcaaccctg
cagcgctcgcccggcgtccagcctcagctcgttctgggtggcgctgcccagacggcttca
cttgggacggcgacggctgttcagacggggactcctcagcgcacggtaccaggggcgacc
accacttcctcagctgccacggaaactatggaaaacgtgaagaaatgtaaaaatttccta
tctacgttaataaaactggcttcatctggcaagcagtctacagagacagcagctaatgtg
aaagagctcgtgcagaatttactggatggaaaaatagaagcagaagatttcacaagcagg
ttataccgagaacttaattcttcacctcaaccttaccttgtgcctttcctgaagaggagc
ttacccgccttgagacagctgacccccgactccgcggccttcatccagcagagccagcag
cagccgccaccgcccacctcgcaggccaccactgcgctcacggccgtggtgctgagtagc
tcggtccagcgcacggccgggaagacggcggccaccgtgaccagtgccctccagccccct
gtgctcagcctcacgcagcccacgcaggtcggcgtcggcaagcaggggcaacccacaccg
ctggtcatccagcagcctccgaagccaggagccctgatccggcccccgcaggtgacgttg
acgcagacacccatggtcgccctgcggcagcctcacaaccggatcatgctcaccacgcct
cagcagatccagctgaacccactgcagccagtccctgtggtgaaacccgccgtgttacct
ggaaccaaagccctttctgctgtctcggcacaagcagctgctgcacagaaaaataaactc
aaggagcctgggggaggttcgtttcgggacgatgatgacattaatgatgttgcatcgatg
gctggagtaaacttgtcagaagaaagtgcaagaatattagccacgaactctgaattggtg
ggcacgctaacgcggtcctgtaaagatgaaaccttcctcctccaagcgcctttgcagaga
agaatattagaaataggtaaaaaacatggtataacggaattacatccagatgtagtaagt
tatgtatcacatgccacgcaacaaaggctacagaatcttgtagagaaaatatcagaaaca
gctcagcagaagaacttttcttacaaggatgacgacagatatgagcaggcgagtgacgtc
cgggcacagctcaagttttttgaacagcttgatcaaatcgaaaagcagaggaaggatgag
caggagcgggagatcctgatgagggcagcaaagtctcggtcaagacaagaagatccagaa
cagttaaggctgaaacagaaggcaaaggagatgcagcaacaggaactggcacaaatgaga
cagcgggacgccaacctcacagcactagcagcgatcgggcccaggaaaaagaggaaagtg
gactgtccggggccgggctcaggagcagaggggtcgggccccggctcagtggtcccaggc
agctcgggtgtcggaacccccagacagttcacgcgacaaagaatcacgcgggtcaacctc
agggacctcatattttgtttagaaaatgaacgtgagacaagccattcactgctgctctac
aaagcattccttaagtga

KEGG   Homo sapiens (human): 6875
Entry
6875              CDS       T01001                                 

Gene name
TAF4B, SPGF13, TAF2C2, TAFII105
Definition
(RefSeq) TATA-box binding protein associated factor 4b
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05016  Huntington disease
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6875 (TAF4B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    6875 (TAF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6875 (TAF4B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6875 (TAF4B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6875 (TAF4B)
   Coactivators
    SAGA/TFTC/STAGA complex
     6875 (TAF4B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6875 (TAF4B)
SSDB
Motif
Pfam: TAF4 TAFH E2F_CC-MB
Other DBs
NCBI-GeneID: 6875
NCBI-ProteinID: NP_005631
OMIM: 601689
HGNC: 11538
Ensembl: ENSG00000141384
Vega: OTTHUMG00000179429
Pharos: Q92750(Tbio)
UniProt: Q92750
LinkDB
Position
18q11.2
AA seq 862 aa
MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQ
PLRSPVGTLVTKVAPVSAPPKVSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIK
SNSGPLMLVSPQQTVTRAETTSNITSRPAVPANPQTVKICTVPNSSSQLIKKVAVTPVKK
LAQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLK
AENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTT
VTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAA
TGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAIC
LPSVKPVVSSAGTTSDKPVIGTPVQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNE
KQVTTISHSSTLTIQKCGQKTMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKN
RIKENVTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLIQSCKDEPFLFIGAL
QKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLTAIAQHRMTTYKASENYILCS
DTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL
IFCMEQEREMKYSRALYLALLK
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgcccgccggcctcaccgaacccgccggcgccgctcccccggctgctgtgagcgcctcg
gggaccgtgaccatggccccggccggggcgctgccggtgcgggtggagagcactccggtg
gccctgggcgccgtgactaaggctcctgtcagcgtctgcgtggagcccacggcgtcccag
cccctgcggtcccccgtggggaccctggtgaccaaagtggctccggtcagcgcccctcct
aaagtcagcagcggccctaggctgcctgctcctcagatagtcgccgtgaaagcccccaac
accacgacaatccagtttcctgctaatttgcagcttcctccaggaaccgttttgattaaa
agtaacagtggtccgttgatgttggtatctcctcagcaaactgtaacaagagccgagacc
acaagtaacataacctcaaggccagcagtaccagcgaatcctcaaacagtcaaaatctgt
acagtgccgaactctagctcacaattaatcaagaaagtggcagtgacacctgttaaaaaa
ttggcacaaataggaactactgtggtaaccactgttccgaagccttcctcagtacaatct
gtggctgtgccaaccagtgtcgtcacagttactcctggaaagccattgaatactgtaact
accctgaagccttcaagtttgggagcatcatccactccttcaaatgagcccaatcttaaa
gcagagaactcagcagctgttcagattaatctttctccgacaatgctagaaaatgtgaag
aaatgcaagaacttccttgcaatgttaataaaactagcatgtagtggatcacagtcccca
gaaatggggcaaaatgtgaagaagctggtggaacaacttttggatgcaaaaatcgaagca
gaagaatttactaggaaactgtatgttgaactcaagtcttcacctcagcctcacctggtt
ccttttcttaagaaaagcgtggttgccttacgacaacttctgcctaactcccagagcttc
atccagcaatgtgttcagcagacttctagtgacatggtcattgctacctgtactacaaca
gtaacaacttctcctgtggtgacaactacagtgtcctcaagccagtctgaaaagtcaatt
attgtttctggagcaacagcacccagaactgtgtcagtgcaaactttgaacccacttgct
ggtccagtgggagcaaaagctggagttgtgacacttcattctgtgggcccaactgctgca
acaggaggaacaacagctggaactggtttgcttcagacttcaaaaccacttgtgacatct
gtggcaaacacagtgaccacggtctcactgcaacctgaaaagccagttgtctctggaaca
gcagtaacactgtcccttccagcagtaacttttggagaaacttcaggtgcagctatttgt
cttccatctgtgaaacctgttgtttcttctgctgggaccacatctgacaagcctgttatt
gggactccagttcaaatcaaacttgcccagccgggccctgtcctttcacaaccagctggg
attccacaggcagttcaagtcaagcaactagtagttcagcagccttcaggaggcaatgaa
aaacaagtgaccacaatttcacattcctcaacattgaccattcagaaatgtggacagaag
acgatgccagtgaacaccataatacctactagtcagtttcctccagcttccattctaaag
caaattactctgcctggaaataaaattctgtcacttcaagcatctcctactcagaaaaat
agaataaaagagaatgtaacatcatgcttccgagatgaggatgacatcaatgatgtgact
tctatggcaggggtcaaccttaatgaagaaaatgcctgcatcttagcaacaaactctgaa
ttggttggcacactcattcagtcatgtaaagatgaaccatttctttttattggagctcta
caaaagagaattttagacattggtaaaaagcatgacattacagaacttaactctgatgct
gtgaacttgatctcccaagcaacacaggaacgactacgaggccttctagaaaaactgact
gcaattgctcagcatcgaatgactacttacaaggcaagtgaaaattacatcctgtgtagt
gataccaggtcacagctcaaatttcttgaaaagctggatcaattggagaagcagagaaag
gatttggaagaaagagaaatgttacttaaggcagccaagagtcgttctaataaagaagat
ccagaacagctgagattaaagcagaaagccaaagagttacagcaattggaacttgcacag
atacagcatagagacgctaatctcacagctcttgcagctattggaccaaggaagaagaga
ccactagaatctggaattgagggcttaaaagacaaccttcttgcttctgggacatccagc
ctgacagccaccaaacagttgcatcgtccaagaatcacgagaatctgcctcagggacttg
atattttgtatggaacaggaacgggagatgaagtattctcgagctctatacctggccctt
ctgaagtga

DBGET integrated database retrieval system