KEGG   Homo sapiens (human): 7078Help
Entry
7078              CDS       T01001                                 

Gene name
TIMP3, HSMRK222, K222, K222TA2, SFD
Definition
(RefSeq) TIMP metallopeptidase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Disease
H00732  Sorsby fundus dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    7078 (TIMP3)
   05205 Proteoglycans in cancer
    7078 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 7078
NCBI-ProteinID: NP_000353
OMIM: 188826
HGNC: 11822
Ensembl: ENSG00000100234
Vega: OTTHUMG00000030784
Pharos: P35625(Tbio)
UniProt: P35625
LinkDB All DBs
Structure
PDB: 

Position
22q12.3
AA seq 211 aa AA seqDB search
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttggctcgggctcatcgtgctcctgggcagctggagcctgggggactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactccgacatc
gtgatccgggccaaggtggtggggaagaagctggtaaaggaggggcccttcggcacgctg
gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccatgtgcag
tacatccatacggaagcttccgagagtctctgtggccttaagctggaggtcaacaagtac
cagtacctgctgacaggtcgcgtctatgatggcaagatgtacacggggctgtgcaacttc
gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaactatcggtatcac
ctgggttgtaactgcaagatcaagtcctgctactacctgccttgctttgtgacttccaag
aacgagtgtctctggaccgacatgctctccaatttcggttaccctggctaccagtccaaa
cactacgcctgcatccggcagaagggcggctactgcagctggtaccgaggatgggccccc
ccggataaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system