KEGG   Homo sapiens (human): 7259Help
Entry
7259              CDS       T01001                                 

Gene name
TSPYL1, TSPYL
Definition
(RefSeq) TSPY like 1
  KO
K11284  TSPY-like 1
Organism
hsa  Homo sapiens (human)
Disease
H02174  Sudden infant death with dysgenesis of the testes syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7259 (TSPYL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     7259 (TSPYL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAP
Motif
Other DBs
NCBI-GeneID: 7259
NCBI-ProteinID: NP_003300
OMIM: 604714
HGNC: 12382
Ensembl: ENSG00000189241
Vega: OTTHUMG00000015427
Pharos: Q9H0U9(Tbio)
UniProt: Q9H0U9
LinkDB All DBs
Position
6q22.1
AA seq 437 aa AA seqDB search
MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALP
PPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRS
LKKGVQGGEKALEICGAQRSASELTAGAEAEAEEVKTGKCATVSAAVAERESAEVVKEGL
AEKEVMEEQMEVEEQPPEGEEIEVAEEDRLEEEAREEEGPWPLHEALRMDPLEAIQLELD
TVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGQDAEM
LRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRG
HEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLREGVRRARRR
PLREPVEIPRPFGFQSG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctggatggggtcaagaggaccactcccctccaaacccacagcatcattatt
tctgaccaagtcccgagcgaccaggacgcacaccagtacctgaggctccgcgaccaaagc
gaggcgacacaggtgatggcggagccgggtgagggaggctcggagaccgtcgcgctcccg
cctccaccgccttcagaggaggggggcgtaccccaggatgccgcgggccgtggcggtact
ccccagatccgagttgttgggggtcgcggtcatgtggcgatcaaagccgggcaggaagag
ggccagcctcccgccgaaggcctggcagccgcttctgtggtgatggcagccgaccgcagc
ctgaaaaagggcgttcagggtggagagaaggccctagaaatctgtggcgcccagagatcc
gcgtctgagctgacggcgggggcggaggctgaggcggaggaggtgaagacaggaaagtgc
gccaccgtctcagcagccgtggctgagagggagagcgctgaggtggtgaaggaaggcctg
gcggagaaggaggtaatggaggagcagatggaggtagaggagcagccgccagaaggtgaa
gaaatagaagtggcggaggaggatagattggaggaggaggcgagggaggaagaagggccc
tggcctttgcatgaggctctccgcatggaccctctggaggccatccagctggaactggac
actgtgaatgctcaggccgacagggccttccaacagctggagcacaagtttgggcggatg
cgtcgacactacctggagcggaggaactacatcattcagaatatcccgggcttctggatg
actgcttttcgaaaccacccccagttgtccgccatgattaggggccaagatgcagagatg
ttaaggtacataaccaatttagaggtgaaggaactcagacaccctagaaccggttgcaag
ttcaagttcttctttagaagaaacccctacttcagaaacaagctgattgtcaaggaatat
gaggtaagatcctccggccgagtggtgtctctttctactccaattatatggcgcaggggg
catgaaccccagtccttcattcgcagaaaccaagacctcatctgcagcttcttcacttgg
ttttcagaccacagccttccagagtccgacaaaattgctgagattattaaagaggatctg
tggccaaatccactgcaatactacctgttgcgtgaaggagtccgtagagcccgacgtcgc
ccgctaagggagcctgtagagatccccaggccctttgggttccagtctggttaa

DBGET integrated database retrieval system