KEGG   Homo sapiens (human): 797Help
Entry
797               CDS       T01001                                 

Gene name
CALCB, CALC2, CGRP-II, CGRP2
Definition
(RefSeq) calcitonin related polypeptide beta
  KO
K12332  calcitonin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    797 (CALCB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    797 (CALCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calc_CGRP_IAPP
Motif
Other DBs
NCBI-GeneID: 797
NCBI-ProteinID: NP_000719
OMIM: 114160
HGNC: 1438
Ensembl: ENSG00000175868
Vega: OTTHUMG00000164629
Pharos: P10092(Tbio)
CPD: C16126
UniProt: P10092
LinkDB All DBs
Position
11p15.2
AA seq 127 aa AA seqDB search
MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
RRRDLQA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccggaagttctcccccttcctggctctcagtatcttggtcctgtaccaggcg
ggcagcctccaggcggcgccattcaggtctgccctggagagcagcccagacccggccaca
ctcagtaaagaggacgcgcgcctcctgctggctgcactggtgcaggactatgtgcagatg
aaggccagtgagctgaagcaggagcaggagacacagggctccagctccgctgcccagaag
agagcctgcaacactgccacctgtgtgactcatcggctggcaggcttgctgagcagatca
gggggcatggtgaagagcaacttcgtgcccaccaatgtgggttccaaagcctttggcagg
cgccgcagggaccttcaagcctga

DBGET integrated database retrieval system