KEGG   Homo sapiens (human): 80854Help
Entry
80854             CDS       T01001                                 

Gene name
SETD7, KMT7, SET7, SET7/9, SET9
Definition
(RefSeq) SET domain containing 7, histone lysine methyltransferase
  KO
K11431  histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    80854 (SETD7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    80854 (SETD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    80854 (SETD7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     80854 (SETD7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     80854 (SETD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MORN SET MORN_2
Motif
Other DBs
NCBI-GeneID: 80854
NCBI-ProteinID: NP_085151
OMIM: 606594
HGNC: 30412
Ensembl: ENSG00000145391
Vega: OTTHUMG00000133385
Pharos: Q8WTS6(Tchem)
UniProt: Q8WTS6
LinkDB All DBs
Structure
PDB: 

Position
4q31.1
AA seq 366 aa AA seqDB search
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgacgacgagatggtggaggaggcggtggaagggcacctggacgatgacgga
ttaccgcacgggttctgcacagtcacctactcctccacagacagatttgaggggaacttt
gttcacggagaaaagaacggacgggggaagttcttcttctttgatggcagcaccctggag
gggtattatgtggatgatgccttgcagggccagggagtttacacttacgaagatggggga
gttctccagggcacgtatgtagacggagagctgaacggtccagcccaggaatatgacaca
gatgggagactgatcttcaaggggcagtataaagataacattcgtcatggagtgtgctgg
atatattacccagatggaggaagccttgtaggagaagtaaatgaagatggggagatgact
ggagagaagatagcctatgtgtaccctgatgagaggaccgcactttatgggaaatttatt
gatggagagatgatagaaggcaaactggctacccttatgtccactgaagaagggaggcct
cactttgaactgatgcctggaaattcagtgtaccactttgataagtcgacttcatcttgc
atttctaccaatgctcttcttccagatccttatgaatcagaaagggtttatgttgctgaa
tctcttatttccagtgctggagaaggacttttttcaaaggtagctgtgggacctaatact
gttatgtctttttataatggagttcgaattacacaccaagaggttgacagcagggactgg
gcccttaatgggaacaccctctcccttgatgaagaaacggtcattgatgtgcctgagccc
tataaccacgtatccaagtactgtgcctccttgggacacaaggcaaatcactccttcact
ccaaactgcatctacgatatgtttgtccacccccgttttgggcccatcaaatgcatccgc
accctgagagcagtggaggccgatgaagagctcaccgttgcctatggctatgaccacagc
ccccccgggaagagtgggcctgaagcccctgagtggtaccaggtggagctgaaggccttc
caggccacccagcaaaagtga

DBGET integrated database retrieval system