KEGG   Homo sapiens (human): 8309
Entry
8309              CDS       T01001                                 

Gene name
ACOX2, BCOX, BRCACOX, BRCOX, CBAS6, THCCox
Definition
(RefSeq) acyl-CoA oxidase 2
  KO
K10214  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase [EC:1.17.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
hsa_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Network
nt06021  beta-Oxidation in peroxisome
nt06022  Bile acid biosynthesis
  Element
N00779  beta-Oxidation, peroxisome, bile acid
N00780  SCP2 deficiency in beta-oxidation
N00802  HSD17B4 deficiency in beta-oxidation
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
Disease
H00628  Congenital bile acid synthesis defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    8309 (ACOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8309 (ACOX2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    8309 (ACOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.3  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase
     8309 (ACOX2)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 8309
NCBI-ProteinID: NP_003491
OMIM: 601641
HGNC: 120
Ensembl: ENSG00000168306
Vega: OTTHUMG00000159154
Pharos: Q99424(Tbio)
UniProt: Q99424
LinkDB
Position
3p14.3
AA seq 681 aa
MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSY
PEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHR
VFVRALRSLGSEEQIAKWDPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVI
HSPTLTATKWWPGDLGRSATHALVQAQLICSGARRGMHAFIVPIRSLQDHTPLPGIIIGD
IGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVEL
LSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHFL
AVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSKL
SGLPSLVTKLSASCTYEGENTVLYLQVARFLVKSYLQTQMSPGSTPQRSLSPSVAYLTAP
DLARCPAQRAADFLCPELYTTAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIHL
QAAKVHCYYVTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGA
QVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNT
QENPAYEEYIRPLLQSWRSKL
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgggcagcccagtgcaccgagtgtcattgggggatacctggagcaggcaaatgcacccc
gacatagagagcgagaggtatatgcagtcctttgacgtggaacggctcaccaacatcctt
gatggaggtgcccagaacactgcactccgcaggaaagttgagagcatcatccacagttac
ccggagtttagctgtaaggacaattatttcatgacccagaatgagcgttataaggctgcc
atgcggagggcattccacatccggttgatagctcggcgcctgggttggttagaagatggt
cgtgaattaggctacgcttacagagccctttctggagacgtggccttaaatatacacaga
gtcttcgtgagagccctcaggagcctgggctcagaggagcagattgccaaatgggaccca
ctctgcaaaaacatccagatcatcgcaacgtatgcacagacagagttgggacatgggaca
tatcttcagggcctggagactgaagccacctatgacgcagccacccaggagtttgtgata
cacagccccacgctgactgccaccaaatggtggcctggagacttgggacggtcagccacc
catgccctggtccaggcccagctgatctgctcaggagccaggcggggcatgcacgctttt
attgtgccaatccggagtcttcaggaccacaccccactgccaggaatcatcattggggac
atcggacccaagatggactttgatcaaacagacaatggcttcctgcagctgaaccatgtg
cgggtccccagggagaacatgctgagtcgctttgcacaggtcttgccagatggcacctac
gtcaaactcggtacagcacagagcaactaccttcccatggtggtggtgcgggtggagctg
ctgtcaggggagatcctccctatactgcagaaggcctgtgtcatcgccatgcgctactcg
gtcatccgccgccaatcccggctccggcccagtgacccagaggcaaaggtcctggactac
cagacacaacagcagaaactctttcctcagctggccatcagttatgccttccatttcctg
gcagtcagcctcttggagttcttccagcactcctacactgccattctgaaccaagacttc
agcttcctgcctgagctccacgcactgagcacgggcatgaaggccatgatgtcagaattc
tgcacccagggagctgagatgtgccgcagggcctgtggcggacatggctactcaaagctg
agtggcctgccatcactggtcaccaaattgtcggcctcctgtacctacgagggtgagaac
acagtgctctacctgcaggtggccaggttcctggtgaagagctacctgcagactcagatg
tcccctggctccacgccacagagatctctctctccatctgtcgcatatctcaccgcacct
gacctggccaggtgtccagcccagagggcagccgacttcctctgcccggagctctacacc
acggcctgggcacatgtggcagtaaggctcataaaggactcagtgcagcatttacagacc
ctgacgcaatccggagctgaccagcacgaggcttggaaccagaccactgtcatacacctc
caggctgctaaggtgcactgctactatgtcactgtgaagggttttacagaagctctggag
aaactagaaaatgaaccagcgattcagcaggtgctcaagcgcctctgtgacctccatgcc
atacatggaatcttgactaactcgggtgactttctccatgacgccttcctgtctggtgcc
caagtggacatggcaagaacagcctacctggacctgctccgcctgatccggaaggatgcc
atcctgttaactgatgcttttgacttcaccgatcagtgtttaaattcagcacttggctgt
tatgatggaaacgtctacgaacgcctgttccagtgggctcagaagtcaccaaccaatact
caggagaaccctgcctatgaggaatatataagaccacttttacaaagttggagatccaag
ctatga

DBGET integrated database retrieval system