KEGG   Homo sapiens (human): 832Help
Entry
832               CDS       T01001                                 

Gene name
CAPZB, CAPB, CAPPB, CAPZ
Definition
(RefSeq) capping actin protein of muscle Z-line subunit beta
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    832 (CAPZB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    832 (CAPZB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    832 (CAPZB)
   04147 Exosome [BR:hsa04147]
    832 (CAPZB)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    832 (CAPZB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     832 (CAPZB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   832 (CAPZB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_actin_cap_B
Motif
Other DBs
NCBI-GeneID: 832
NCBI-ProteinID: NP_001193469
OMIM: 601572
HGNC: 1491
Ensembl: ENSG00000077549
Vega: OTTHUMG00000002556
Pharos: P47756(Tbio)
UniProt: P47756 Q7L4N0
LinkDB All DBs
Position
1p36.13
AA seq 277 aa AA seqDB search
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcagcagctggactgtgccttggacctaatgaggcgcctgcctccccagcaa
atcgagaaaaacctcagcgacctgatcgacctggtccccagtctatgtgaggatctcctg
tcttctgttgaccagccactgaaaattgccagagacaaggtggtgggaaaggattacctt
ttgtgtgactacaacagagatggggactcctataggtcaccatggagtaacaagtatgac
cctcccttggaggatggggccatgccgtcagctcggctgagaaagctggaggtggaagcc
aacaatgcctttgaccagtatcgagacctgtattttgaaggtggcgtctcatctgtctac
ctctgggatctggatcatggctttgctggagtgatcctcataaagaaggctggagatgga
tcaaagaagatcaaaggctgctgggattccatccacgtggtagaagtgcaggagaaatcc
agcggtcgcaccgcccattacaagttgacctccacggtgatgctgtggctgcagaccaac
aaatctggctctggcaccatgaacctcggaggcagccttaccagacagatggagaaggat
gaaactgtgagtgactgctccccacacatagccaacatcgggcgcctggtagaggacatg
gaaaataaaatcagaagtacgctgaacgagatctactttggaaaaacaaaggatatcgtc
aatgggctgagatctattgatgctatccctgacaaccaaaagtttaagcagttgcagagg
gagctctctcaagtgctgacccagcgccagatctacatccagcctgataattaa

DBGET integrated database retrieval system