KEGG   Homo sapiens (human): 8632
Entry
8632              CDS       T01001                                 

Gene name
DNAH17, DNAHL1, DNEL2, SPGF39
Definition
(RefSeq) dynein axonemal heavy chain 17
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    8632 (DNAH17)
   05016 Huntington disease
    8632 (DNAH17)
   05022 Pathways of neurodegeneration - multiple diseases
    8632 (DNAH17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8632 (DNAH17)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     8632 (DNAH17)
SSDB
Motif
Pfam: MT DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy AAA_5 Dynein_AAA_lid AAA_16 AAA_22 AAA_30 Sigma54_activat Spc7 ATP_bind_1 ABC_tran Zeta_toxin
Other DBs
NCBI-GeneID: 8632
NCBI-ProteinID: NP_775899
OMIM: 610063
HGNC: 2946
Ensembl: ENSG00000187775
Vega: OTTHUMG00000150216
UniProt: Q9UFH2
LinkDB
Position
17q25.3
AA seq 4462 aa
MTMAPDVRLEYLEEVASIVLKFKPDKWSKLIGAEENVALFTEFFEKPDVQVLVLTLNAAG
MIIPCLGFPQSLKSKGVYFIKTKSENINKDNYRARLLYGDISPTPVDQLIAVVEEVLSSL
LNQSENMAGWPQVVSEDIVKQVHRLKNEMFVMSGKIKGKTLLPIPEHLGSLDGTLESMER
IPSSLDNLLLHAIETTIIDWSHQIRDVLSKDSAQALLDGLHPLPQVEFEFWDTRLLNLKC
IHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTNVTEGLKEANDIVLYLKPLRILLEEME
QADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLK
GLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSF
FQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLD
PGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAE
VAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLE
VSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQWVAGVDQDCHFNLGQPL
ILRDAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELI
VGWYNEIKTIVKAVEFLLIKSELEAIDVKLLSAETTLFWNGEGVFQYIQEVREILHNLQN
RMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQ
AMVAENAELFRADTLSLPWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFE
IRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMDLEDNT
DLIEMREEVSSLVINAMKEAEEYQDSFERYSYLWTDNLQEFMKNFLIYGCAVTAEDLDTW
TDDTIPKTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSTIRRW
GFMFKRHLSNHVTNSLADLEAFMKVARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAATD
NMFEPLKQTIELLKTYGEEMPEEIHLKLQELPEHWANTKKLAIQVKLTVAPLQANEVSIL
RRKCQQFELKQHEFRERFRREAPFSFSDPNPYKSLNKQQKSISAMEGIMEALSKSGGLFE
VPVPDYKQLKACHREVRLLKELWDMVVVVNTSIEDWKTTKWKDINVEQMDIDCKKFAKDM
RSLDKEMKTWDAFVGLDNTVKNVITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSEET
TLADLLQLNLHSYEDEVRNIVDKAVKESGMEKVLKALDSTWSMMEFQHEPHPRTGTMMLK
SSEVLVETLEDNQVQLQNLMMSKYLAHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLE
SIFIGSEDIRTQLPGDSQRFDDINQEFKALMEDAVKTPNVVEATSKPGLYNKLEALKKSL
AICEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRL
DASDKPLKVGLGMYSKEDEYMVFDQECDLSGQVEVWLNRVLDRMCSTLRHEIPEAVVTYE
EKPREQWILDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIRDYNKKQISQLNVLITL
LMGNLNAGDRMKIMTICTIDVHARDVVAKMIVAKVESSQAFTWQAQLRHRWDEEKRHCFA
NICDAQIQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDL
GRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQ
DAIRAKKKAFNFLGEIIGLIPTVGIFITMNPGYAGRAELPENLKALFRPCAMVVPDFELI
CEIMLMAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPS
RAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELK
LQAEDSFVLKVVQLEELLQVRHSVFIVGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPK
AVTCDELFGIINPVTREWKDGLFSTIMRDLANITHDGPKWIILDGDIDPMWIESLNTVMD
DNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIE
RRKVQSEKANLMILFDKYLPTCLDKLRFGFKKITPVPEITVIQTILYLLECLLTEKTVPP
DSPRELYELYFVFTCFWAFGGAMFQDQLVDYRVEFSKWWINEFKTIKFPSQGTIFDYYID
PDTKKFLPWTDKVPSFELDPDVPLQASLVHTTETIRIRYFMDLLMEKSWPVMLVGNAGTG
KSVLMGDKLESLNTDNYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLVYF
IDDMNMPEVDKYGTVAPHTLIRQHMDHRHWYDRHKLTLKDIHNCQYVACMNPTSGSFTID
SRLQRHFCVFAVSFPGQEALTTIYNTILTQHLAFRSVSMAIQRISSQLVAAALALHQKIT
ATFLPTAIKFHYVFNLRDLSNIFQGLLFSTAEVLKTPLDLVRLWLHETERVYGDKMVDEK
DQETLHRVTMASTKKFFDDLGDELLFAKPNIFCHFAQGIGDPKYVPVTDMAPLNKLLVDV
LDSYNEVNAVMNLVLFEDAVAHICRINRILESPRGNALLVGVGGSGKQSLSRLAAYISGL
DVFQITLKKGYGIPDLKIDLAAQYIKAAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGE
IPGLFMEDEVENIISSMRPQVKSLGMNDTRETCWKFFIEKVRRQLKVILCFSPVGSVLRV
RARKFPAVVNCTAIDWFHEWPEDALVSVSARFLEETEGIPWEVKASISFFMSYVHTTVNE
MSRVYLATERRYNYTTPKTFLEQIKLYQNLLAKKRTELVAKIERLENGLMKLQSTASQVD
DLKAKLAIQEAELKQKNESADQLIQVVGIEAEKVSKEKAIADQEEVKVEVINKNVTEKQK
ACETDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPK
DKSWKAAKIMMGKVDTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAG
LCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAF
EKATAEKIKCQQEADATNRVILLANRLVGGLASENIRWAESVENFRSQGVTLCGDVLLIS
AFVSYVGYFTKKYRNELMEKFWIPYIHNLKVPIPITNGLDPLSLLTDDADVATWNNQGLP
SDRMSTENATILGNTERWPLIVDAQLQGIKWIKNKYRSELKAIRLGQKSYLDVIEQAISE
GDTLLIENIGETVDPVLDPLLGRNTIKKGKYIKIGDKEVEYHPKFRLILHTKYFNPHYKP
EMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLL
ARLSAASGNFLGDTALVENLETTKHTASEIEEKVVEAKITEVKINEARENYRPAAERASL
LYFILNDLNKINPVYQFSLKAFNVVFEKAIQRTTPANEVKQRVINLTDEITYSVYMYTAR
GLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKAL
SEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTY
AIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVDPLKDVEALGKKLGFTI
DNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHE
DYRVFISAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKE
MEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDD
LRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEY
IDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAV
LDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGEL
TITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTV
WLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFME
GARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTF
NLKTKEKAAKWILAAVALLLQV
NT seq 13389 nt   +upstreamnt  +downstreamnt
atgacaatggccccggacgtcagactagagtatctggaggaagttgcctccatcgtcctg
aagttcaagccggacaagtggagcaagctgataggcgccgaggagaacgtggccctgttc
acagagttctttgaaaagcccgacgtccaggtgctggtgctgacgctcaatgcagccggc
atgatcataccctgcctgggcttcccccagtccctcaagtccaaaggggtttacttcatc
aagacaaagtccgagaacatcaacaaggacaactacagggcccggctcctttacggcgac
atcagccccacacccgtggaccagctgatcgcggtggtggaggaggtcctctcttctctg
ttaaaccaaagtgagaacatggctggatggccccaggtggtctcggaagacatcgtgaag
caggtccacaggctgaagaatgaaatgtttgtgatgagtggcaagatcaaaggcaaaacc
ttgctgcctattccggagcacctgggcagcctggatggcacgctggagtccatggagagg
atcccctcttcactggacaacttgctcctgcacgccattgaaaccaccatcatcgactgg
tcccaccagatccgggatgtgctgagcaaagactcagcccaggcgctgctggatgggctg
caccccctgccccaagtggagttcgagttctgggacactcggctgctgaacctcaagtgc
atccatgaacagctaaacagacccaaagtgaacaagattgttgagatcctagagaaagcc
aaaagctgctactggccagccctgcaaaacgtttacaccaacgtcactgaagggctgaag
gaagccaacgacatcgtgctctatttgaagcccctacggatcctgctggaggagatggaa
caagccgacttcacgatgctccccaccttcattgccaaggtgctggacaccatctgcttc
atctgggccacctctgagtactataacacacctgccaggatcatcgtcatcctgcaggag
ttctgcaaccaaatcatcgagatgacacgaaccttcctgagcccggaagaggtgctgaag
ggcctgcaaggtgaaatcgaggaagtcctgagtggcatctccctggctgtaaatgtgctg
aaggagctctaccagacgtacgacttctgctgcgtgaacatgaagcttttctttaaggac
aaagagcccgtgccttgggaattcccttcttctcttgccttttccaggataaattccttc
ttccagcgcatccagaccattgaggaactctataaaacagcaattgagtttctgaagctg
gagaaaatcgagcttgggggcgtgcgtgggaacctcctcgggagcctggtgacccgtatc
tatgatgaggtctttgagctggtgaaggtttttgccgactgcaaatatgatcccttggac
cctggagactcgaattttgaccgtgattatgctgattttgagatcaaaatccaagacctg
gataggaggctggccacgatcttttgccaaggatttgatgactgcagctgtatcaagtcc
tccgcaaagctcctgtacatgtgtgggggcctcatggagcggcccctgattcttgccgag
gtggcgcccaggtattcagtcatgctggagctgtttgacgctgagctagacaatgctaag
atcttgtacgatgcccagatggcggcctccgaggaggggaacatccccctgatccacaaa
aacatgcctcccgtggccgggcagctcaaatggagcctggagctgcaggagaggctagag
gtgtccatgaaacacctgaagcacgtcgaacacccggtcatgtctggagcagaggccaag
ctgacctatcagaagtatgacgagatgatggagctgctgaggtgccaccgcgagaagatc
taccagcagtgggtggcgggcgtggaccaggactgccactttaacctggggcagccgctg
attctgcgggacgccgctagcaacctcatccacgtcaacttcagcaaagcgttggtggca
gttctgagagaagtcaagtatttgaatttccagcaacagaaagagattccagacagtgcg
gagagtctgttctcagagaacgaaactttccggaagtttgtgggcaacctggagctcatc
gttggctggtataatgagataaagactatagtgaaggcagtagaatttctactaataaag
tcagaactggaagcaattgatgtcaagttattgagcgctgaaacgacattattctggaat
ggcgaaggtgtgtttcagtacattcaagaggtgcgagaaattctgcacaacttgcagaac
aggatgcaaaaggcaaaacaaaatatagaaggaatttcccaggctatgaaggactggtcg
gccaacccgctgtttgaaagaaaggacaataagaaagaggccctgttagacttggatgga
agaattgccaacctcaacaagcgctacgcagcagtcagggatgctggagtgaagatccaa
gccatggttgcagaaaacgcagaactattcagggcagacacactgagcctgccctggaag
gattatgtcatctacattgacgacatggtcttagatgaatttgaccagttcattcgcaaa
tctctgagtttcctaatggacaacatggttatagatgagagtatcgctcccctgtttgag
atccgcatggagctggacgaggatgggctgaccttcaacccgaccctggaggtgggctca
gatcgcggcttcctggcactgatcgagggcctggtcaacgacatctacaacgtagccagg
ctcatccctcggctggccaaggacaggatgaactacaagatggacctggaagataacaca
gacctcatagagatgagggaggaggtgtccagcctggtcatcaatgccatgaaggaggcc
gaggagtaccaggattcctttgagaggtactcctacctctggacggacaacctgcaggag
tttatgaagaatttcctgatatatgggtgtgcagtcactgcggaggacttggacacctgg
acagatgacaccatccccaagacaccgcccaccctggctcagttccaggagcagatcgac
tcctacgagaagctgtatgaggaggtgtccaagtgcgagaacaccaaggtgttccacggc
tggctgcagtgcgactgccgccccttcaagcaggccctgctcagcacaatccggcgctgg
ggcttcatgttcaagcggcacctgagcaaccacgtcaccaacagcctggctgacctggaa
gccttcatgaaagtcgccagaatgggcttgaccaagcccctcaaggagggggactatgat
gggcttgtggaggtgatggggcacctgatgaaagtcaaggagaggcaagcagccaccgac
aacatgtttgagcccctgaagcaaaccatcgagctgctcaagacctacggggaggagatg
ccagaggagatccacttgaagctgcaggagctgccggagcactgggcaaataccaagaaa
ctggccattcaggtgaagctgaccgtggcaccactccaggccaacgaggtcagcatcctg
cggcggaaatgccagcaattcgagctcaagcaacatgagttcagggagaggttcaggcgc
gaggccccgttctccttcagcgaccccaacccctacaagtccctgaataagcaacaaaag
agcatctccgccatggaaggcatcatggaggcgctgtccaagtccgggggcctgttcgag
gtccccgtcccagactacaagcagctcaaggcctgccaccgggaggtccgcctactgaag
gagctctgggacatggttgttgtggtaaataccagcatcgaggactggaagaccaccaag
tggaaagatatcaacgttgagcagatggacatagattgtaagaagtttgccaaggacatg
aggtctttggacaaggagatgaaaacctgggatgccttcgtggggctcgacaacaccgtg
aaaaacgtgatcacgtccctgcgtgccgtgagcgagctgcagaaccctgccattcgggaa
cgccactggcagcagctcatgcaggccacccaggtgaaatttaaaatgtcagaagagacg
accctggcagatttactgcagctgaacctccacagttacgaggatgaggtccgcaacatc
gtggacaaggccgtgaaggagtcgggcatggaaaaggtgctgaaagccctggacagtacc
tggagcatgatggaattccagcacgagccgcacccgcggacaggcaccatgatgctcaag
tccagcgaggtgctggtggagacgctggaggacaaccaggtgcagctgcagaacctgatg
atgtccaagtacctggcccacttcctgaaggaggtgacaagctggcagcagaagctgtcc
acggcggactccgtcatctccatctggtttgaggtccagcgaacctggagccacctggag
agcatcttcatcggctccgaagacatccgcacccagctcccgggggactcccagcgcttt
gacgacatcaaccaggaattcaaggccttgatggaagatgcagtgaaaacacccaacgtg
gtggaagccaccagcaaacccggcctctacaataaactggaggccctgaagaagagcttg
gccatctgtgaaaaggctttggcagagtatttagagacgaaaagactggctttcccccgg
ttctattttgtctcctcggctgacctcctggacattctctccaatggcaatgaccccgtg
gaggtgagccgccacctgtccaaactcttcgatagcctgtgtaaactgaagttccggctc
gatgccagtgacaaacctctcaaggtgggcctgggaatgtacagcaaggaggacgagtac
atggtttttgatcaggaatgcgacctctcggggcaggtggaagtgtggctgaatcgagtg
ctggaccgaatgtgctctaccctccggcacgaaatcccagaggccgtggtgacctacgaa
gagaagccgagggagcagtggatcctggactacccagcccaggtggccctgacttgcacc
cagatctggtggacgaccgaggtgggcctggcatttgccaggctggaggaaggctatgaa
aacgctatcagagattataacaaaaagcagattagccagctgaacgtactcatcacgctg
ctcatggggaacctcaacgctggcgacaggatgaagatcatgaccatctgcaccatcgat
gtgcacgcacgggacgtggtggccaaaatgatcgtggccaaggtggagagttctcaggcc
ttcacctggcaggcccagctccggcatcgctgggacgaagagaagcgacactgctttgcc
aacatctgcgatgcccaaatccagtattcctatgagtatctgggcaacacgccgcggctg
gtcatcaccccactcactgacaggtgctatatcaccctgacccagtccctccatctcatc
atgggtggagcccctgccggccccgctgggaccggcaagactgagacgaccaaggacctg
ggcagagccctgggcaccatggtctacgtcttcaactgctccgagcagatggactacaag
tcctgtggaaatatctacaagggcctggcccagacgggagcctggggctgctttgacgag
tttaatcgcatctcagtggaagtcttgtctgtgattgccgtgcaggtaaaatgtgtccag
gatgcaattcgggccaagaaaaaagcattcaatttcctgggagagatcataggcctcatt
cccaccgtcggtatcttcatcaccatgaaccctgggtacgccggacgcgcggagctgcct
gagaacctaaaagccttattcaggccctgtgccatggtcgtccccgacttcgaactgata
tgtgagatcatgctcatggccgagggctttctggaagcccgccttctggccaggaagttc
atcaccctgtacaccttgtgcaaggagctgctctcgaagcaggatcattacgactggggc
ctgagagccatcaagtctgtgctggtggtggccggctccctgaagaggggcgaccccagc
cgggcagaggaccaggtgctcatgcgggcgctgagagacttcaacatccccaagattgtg
acagacgacctgcccgtattcatgggactgatcggggacctcttcccggctctggacgtg
cctcggaaacgggacctgaattttgaaaagatcatcaagcagagcatcgtggagctcaag
ctgcaggcggaggacagcttcgtgctgaaggtggtgcagctggaggagctgctgcaggtc
cgccactccgtgttcatcgtcgggaatgcgggcagcggcaaatctcaggtcctcaaatcc
ctcaacaagacctatcagaacctgaagaggaagccggtcgccgtggacctggaccccaag
gccgtcacctgcgacgagctctttggcatcatcaacccagtgaccagggaatggaaagat
ggcctgttctccaccatcatgcgagacctggccaacatcacccatgacggccccaagtgg
atcatccttgacggagacatagaccccatgtggatcgagtctctcaacacagtcatggat
gacaacaaggtcctcaccctggccagcaacgagcggatccccctgaaccgcaccatgagg
ctggtgttcgaaatcagccacctgaggacggccaccccagccaccgtttccagagccggc
atcctctacatcaacccagccgacctgggatggaacccggtggtgagcagctggatcgag
aggcgcaaggtgcagtcggagaaggccaacctgatgatcctctttgacaagtacctgccc
acgtgcctggacaagttgcgctttgggttcaagaagatcacgccagtgccggagatcacg
gtgatccaaacgattctgtacctgctggagtgcctgctcacggagaagaccgtgcccccc
gactcccccagggagctgtacgagctgtacttcgtgttcacctgcttctgggccttcggt
ggcgccatgttccaggaccagcttgtggattatcgagtggagttcagtaaatggtggatc
aacgaattcaagactatcaagttcccctcgcagggaacgatttttgactactacattgat
cctgacacaaaaaagttcctgccctggacagataaagtgccctcctttgagctggatccc
gatgtcccactgcaggcctctttggtccacaccacggaaaccatccgcatccgctacttc
atggacctgctcatggagaagtcctggccggtgatgctggtggggaacgcggggacgggc
aagtcggtgctgatgggggacaagctggaaagcctgaacacggacaactacctggtgcag
gctgtgcccttcaacttctacacgacctcagccatgctgcagggggtgctggagaagccg
ctggagaagaaatcggggaggaactacgggccgccaggcactaagaagctcgtctacttc
atcgacgacatgaacatgcccgaggtggacaagtatgggacggtggccccgcacaccctc
atccggcagcacatggaccaccggcactggtatgacagacataagctgacgttaaaagat
atccataattgtcagtacgtggcctgcatgaaccccacttccggatccttcaccatcgac
tccaggcttcagcgccatttctgcgtgtttgctgtgagcttccccggccaggaggccctc
accaccatctacaacacaatcctgacgcagcacctggccttccgctcggtctccatggct
atccagaggataagcagccagctggtggccgcggccctggctttgcatcagaaaatcacg
gcaacatttcttcccacggccattaagtttcattatgtcttcaacctcagggacctctcc
aatattttccagggactcttattttccacagcagaagttctgaaaaccccactggacctc
gtccgcctttggctacatgagactgaacgagtgtatggtgacaaaatggttgacgaaaaa
gaccaggaaacattgcatagagtcaccatggcctccaccaagaagttctttgatgatctt
ggtgatgaactcttatttgccaagccaaatatcttctgccactttgctcaagggattggc
gatcccaaatatgttcctgtaaccgacatggctcctctgaacaagctcctcgtggacgtc
ctggacagctacaatgaagttaatgcagtcatgaatttggtgctgtttgaggacgccgtg
gctcacatctgcaggattaatcgcatcctggagtctccccgggggaatgccctgctggtg
ggggtgggcggcagtggcaaacagagcctctcccgcctggcagcgtacatcagcgggctt
gacgtgtttcagatcaccctcaagaagggctacgggatccccgacctcaagattgacctc
gctgctcagtacataaaggctgccgtgaagaacgttccctcggtgttcctgatgacagac
tcccaggtggccgaggagcagtttctggtgctgatcaatgacctgctggcctcaggagag
atccctgggctgtttatggaggacgaggtggagaacatcatctcctccatgcgaccccaa
gtcaagtcccttggcatgaatgacactcgggaaacatgttggaagttcttcatcgaaaaa
gtgcgcagacagctcaaggtgatcctgtgtttctcccctgtgggctccgtgctgcgggta
cgagccagaaagttcccagctgtggtcaactgcacggccatcgactggttccacgagtgg
ccggaagatgcgctggtgtccgtcagcgcccgcttcctggaggagactgaggggattccg
tgggaagtcaaggcctccatcagcttcttcatgtcctacgtgcacaccaccgtcaacgag
atgtccagggtatacctggctactgagaggcgctacaactacaccacacccaaaaccttt
ctggagcagatcaaactgtaccagaacctgctggccaagaagagaacggaacttgttgcc
aaaatcgagaggctggagaacggcctgatgaagctgcagagcacggcttcccaggtggat
gatttgaaagccaagttggcgattcaggaggctgagctcaagcagaagaatgagagcgca
gaccaactgatccaggtggtcggcatcgaggccgagaaggtcagcaaagagaaggccatt
gctgaccaggaagaagtcaaggtcgaggtcatcaataagaacgtcactgagaagcaaaag
gcctgtgaaacagacctggccaaagcagaaccggccctgctggcagcccaggaggctctg
gacactctgaataagaacaacctgacagagctgaagtcctttgggtccccgccggatgct
gtggtcaacgtcaccgccgccgtcatgattctgaccgcacctgggggcaagatccccaag
gacaagagctggaaggcggccaagatcatgatgggcaaggtggacaccttcctagactcc
ctgaagaagttcgacaaggagcacatccctgaggcctgcctgaaggccttcaagccctac
caaggcaacccgacgttcgaccccgagttcatccgctccaagtccacggccgccgccggc
ctgtgctcctggtgcatcaacatcgtccgcttctacgaggtctactgcgacgtggcgccc
aagaggcaggcactggaggaggctaatgcagagctggcagaggcacaagagaagctgtcc
cggatcaaaaacaagattgccgaacttaacgccaacctgagcaacctaacctcagcgttt
gaaaaagcaacagctgagaaaatcaagtgtcagcaagaggccgatgccacgaacagggtg
atcttactggcgaacaggctggtcgggggattagcatcggaaaacatccgctgggctgag
tctgtggagaacttcaggagccagggggtcacgctgtgtggggacgtcctgctcatctct
gccttcgtgtcctacgtgggctacttcaccaagaaataccggaatgagctgatggagaaa
ttctggatcccttacatacataacttaaaggtccccatcccgatcacgaatggcctggat
cccttgagcctgctgacagatgacgcggacgtggccacctggaacaaccagggcctcccc
agcgaccgcatgtccaccgagaatgccaccatcctgggcaacaccgagcggtggccgctg
atcgtggacgcccagctccaaggaatcaagtggatcaaaaacaaatacaggagtgaactg
aaagccatccgcctgggacagaagagctacctggatgtcatcgagcaggccatctcggaa
ggggacaccttgctcattgagaacatcggcgaaaccgtggaccccgtgctggaccctcta
ctgggcaggaacacgattaaaaagggaaagtacattaagatcggtgacaaggaggtggag
taccaccccaagttccgcctgatcctacacaccaagtacttcaacccacactacaagcca
gagatgcaggctcagtgcaccctcatcaacttcctggtcaccagggatggactcgaggac
caactcttggccgctgtggtggccaaagagcgcccagatctggaacagctgaaggcaaac
ctcaccaagtctcaaaacgaatttaagattgttctgaaagagctggaagattcgctcctg
gcccgtctgtcggctgcgtcggggaactttctgggagacacggccttggtggagaatctg
gagaccaccaagcacacagccagcgagatcgaggagaaggtggtggaggcaaaaatcaca
gaagttaaaatcaacgaagcgagagagaactaccgcccggctgcggagagggcatctctg
ctctacttcatactgaacgatctcaacaaaatcaaccccgtctaccagttctccctcaag
gccttcaacgtggtgtttgagaaagccatccagaggaccacccctgccaacgaggtgaag
cagcgggtgatcaacctgacggacgagatcacctactccgtctacatgtacacggcccgg
ggactcttcgagagggacaaactcattttcctggcacaagttacgtttcaggtcctgtcc
atgaagaaggagctgaacccagtggagctggatttcctcctgcggttcccttttaaggcc
ggagtggtctcaccagtggacttcctccagcatcaaggctggggcgggatcaaggccctc
tcggagatggatgagttcaaaaatctggacagtgacatcgaaggatctgccaagcgctgg
aaaaagctggtggagtcggaagcccccgagaaggagatcttccccaaggagtggaagaac
aagacggccctgcagaagctgtgcatggtgcgctgcctgcggccagatcgcatgacctac
gctatcaagaacttcgtggaggaaaagatgggcagcaagttcgtggaaggccggagtgtt
gagttttctaagtcctacgaggagagcagcccctccacgtcaatcttcttcatcctctcc
ccgggggttgaccccttgaaagacgtggaagccctgggaaaaaaactagggtttaccata
gacaatggaaaactccataatgtgtccctggggcagggacaagaggtggtggctgagaac
gccctggacgtggctgcagagaaaggacactgggtcattctgcagaatatccacctggtg
gcccggtggctgggaacactggacaagaagctggagcactacagcacgggcagccatgag
gactaccgggtgttcatcagcgcggagcctgcccccagccccgagacccacatcatcccc
cagggcattctggagaacgccatcaagatcaccaacgagccccccacgggcatgcacgcc
aacttgcacaaggccctggacctgttcacccaggacaccctggagatgtgcaccaaggag
atggagttcaagtgcatgctcttcgccctgtgctacttccacgctgtggtggcagagagg
cgcaagttcggcgcccagggctggaaccggtcgtaccccttcaacaacggggacctcacc
atctccatcaacgtgctctacaactacctggaggccaaccccaaggtgccctgggacgat
ctccgctacctttttggtgaaatcatgtatggcggccacatcacagatgactgggaccgt
cggctgtgcaggacctacctggctgaatacatccggacggagatgctggagggagacgtc
ctgctggcccccggctttcagatcccccccaacctggactacaagggttaccacgaatac
atcgatgagaacctgccccctgagagtccctatctgtatggcctgcaccccaacgcagag
attggctttctgacggtcacctcagagaagctgttccgcactgtcctggaaatgcagcca
aaagagacggactcgggggcaggcacgggagtgtcccgcgaggagaaggtgaaggccgtg
ctggacgacatcctggagaagattccggagactttcaacatggctgagatcatggcaaag
gcagcggaaaagaccccctacgtggtagtcgcctttcaagaatgtgaaagaatgaacatc
ctgaccaacgaaatgcgccgttcgctcaaggagctgaacctggggctgaagggagaactg
accatcacgaccgacgtggaagatctgtccacggctctcttctatgacaccgtgcctgat
acgtgggtggcccgggcctacccctccatgatgggcctggcggcctggtacgcagacctg
ctgctccgcatcagggaactcgaggcctggacgacagactttgccctgcccaccaccgtg
tggctggccggcttcttcaacccccagtcgttcctcacggccatcatgcagtccatggcc
aggaagaacgagtggcccctggacaagatgtgtctgtctgtcgaggtgaccaagaaaaac
cgagaggacatgaccgctcctccgcgagagggctcctacgtgtacggactcttcatggaa
ggggctcgctgggacacccagactggagtcatcgctgaagcgcggctgaaagagctgacc
ccggccatgcctgtcatcttcatcaaggccattcctgtggaccgcatggagaccaagaac
atctatgagtgtcccgtgtacaaaacacgcatccgcggccccacctatgtctggaccttt
aacttgaagaccaaagagaaggcagcgaagtggatcctggcagccgtggcgctgctccta
caggtttag

DBGET integrated database retrieval system