KEGG   Homo sapiens (human): 8685Help
Entry
8685              CDS       T01001                                 

Gene name
MARCO, SCARA2, SR-A6
Definition
(RefSeq) macrophage receptor with collagenous structure
  KO
K13884  macrophage receptor with collagenous structure
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    8685 (MARCO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8685 (MARCO)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    8685 (MARCO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen SRCR SRCR_2
Motif
Other DBs
NCBI-GeneID: 8685
NCBI-ProteinID: NP_006761
OMIM: 604870
HGNC: 6895
Ensembl: ENSG00000019169
Vega: OTTHUMG00000131400
Pharos: Q9UEW3(Tbio)
UniProt: Q9UEW3 Q4ZG40
LinkDB All DBs
Position
2q14.2
AA seq 520 aa AA seqDB search
MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
TWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
GAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
GRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQ
IWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataagaaaattctcaaggaggacgagctcttgagtgagacccaacaagctgct
tttcaccaaattgcaatggagcctttcgaaatcaatgttccaaagcccaagaggagaaat
ggggtgaacttctccctagctgtggtggtcatctacctgatcctgctcaccgctggcgct
gggctgctggtggtccaagttctgaatctgcaggcgcggctccgggtcctggagatgtat
ttcctcaatgacactctggcggctgaggacagcccgtccttctccttgctgcagtcagca
caccctggagaacacctggctcagggtgcatcgaggctgcaagtcctgcaggcccaactc
acctgggtccgcgtcagccatgagcacttgctgcagcgggtagacaacttcactcagaac
ccagggatgttcagaatcaaaggtgaacaaggcgccccaggtcttcaaggtcacaagggg
gccatgggcatgcctggtgcccctggcccgccgggaccacctgctgagaagggagccaag
ggggctatgggacgagatggagcaacaggcccctcgggaccccaaggcccaccgggagtc
aagggagaggcgggcctccaaggaccccagggtgctccagggaagcaaggagccactggc
accccaggaccccaaggagagaagggcagcaaaggcgatgggggtctcattggcccaaaa
ggggaaactggaactaagggagagaaaggagacctgggtctcccaggaagcaaaggggac
aggggcatgaaaggagatgcaggggtcatggggcctcctggagcccaggggagtaaaggt
gacttcgggaggccaggcccaccaggtttggctggttttcctggagctaaaggagatcaa
ggacaacctggactgcagggtgttccgggccctcctggtgcagtgggacacccaggtgcc
aagggtgagcctggcagtgctggctcccctgggcgagcaggacttccagggagccccggg
agtccaggagccacaggcctgaaaggaagcaaaggggacacaggacttcaaggacagcaa
ggaagaaaaggagaatcaggagttccaggccctgcaggtgtgaagggagaacaggggagc
ccagggctggcaggtcccaagggagcccctggacaagctggccagaagggagaccaggga
gtgaaaggatcttctggggagcaaggagtaaagggagaaaaaggtgaaagaggtgaaaac
tcagtgtccgtcaggattgtcggcagtagtaaccgaggccgggctgaagtttactacagt
ggtacctgggggacaatttgcgatgacgagtggcaaaattctgatgccattgtcttctgc
cgcatgctgggttactccaaaggaagggccctgtacaaagtgggagctggcactgggcag
atctggctggataatgttcagtgtcggggcacggagagtaccctgtggagctgcaccaag
aatagctggggccatcatgactgcagccacgaggaggacgcaggcgtggagtgcagcgtc
tga

DBGET integrated database retrieval system