KEGG   Homo sapiens (human): 8986Help
Entry
8986              CDS       T01001                                 

Gene name
RPS6KA4, MSK2, RSK-B, S6K-alpha-4
Definition
(RefSeq) ribosomal protein S6 kinase A4
  KO
K16510  ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04668  TNF signaling pathway
Network
nt06123  TNF signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00444  TNF-p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8986 (RPS6KA4)
   04668 TNF signaling pathway
    8986 (RPS6KA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8986 (RPS6KA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8986 (RPS6KA4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   8986 (RPS6KA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo Pkinase_fungal RIO1 Pkinase_C FTA2 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 8986
NCBI-ProteinID: NP_003933
OMIM: 603606
HGNC: 10433
Ensembl: ENSG00000162302
Vega: OTTHUMG00000046094
Pharos: O75676(Tchem)
UniProt: O75676 A0PJF8
LinkDB All DBs
Position
11q13.1
AA seq 772 aa AA seqDB search
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgaggacgacgatgagagctgcgccgtggagctgcggatcacagaagccaac
ctgaccgggcacgaggagaaggtgagcgtggagaacttcgagctgctcaaggtgctgggc
acgggagcctacggcaaggtgttcctggtgcggaaggcgggcgggcacgacgcggggaag
ctgtacgccatgaaggtgctgcgcaaggcggcgctggtgcagcgcgccaagacgcaagag
cacacgcgcaccgagcgctcggtgctggagctggtgcgccaggcgcccttcctggtcacg
ctgcactacgctttccagacggatgccaagctgcacctcatcctggactatgtgagcggc
ggggagatgttcacccacctctaccagcgccagtacttcaaggaggctgaggtgcgcgtg
tatgggggtgagatcgtgctggccctggaacacctgcacaagctcggcatcatttaccga
gacctgaaactggagaatgtgctgctggactccgagggccacattgtcctcacggacttc
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcacc
atcgagtacatggcccccgaaatcatccgtagcaagacggggcatggcaaggctgtggac
tggtggagcctgggcatcttgctcttcgagctgctgacgggggcctcgcccttcaccctg
gagggcgagaggaacacgcaggctgaggtgtctcgacggatcctgaagtgctcccctccc
ttcccccctcggatcgggcccgtggcgcaggacctgctgcagcggctgctttgtaaggat
cctaagaagcgattgggcgcggggccccagggggcacaagaagtccggaaccatcccttc
ttccagggcctcgattgggtggctctggctgccaggaagattccagccccattccggccc
caaatccgctcagagctggatgtgggcaactttgcggaggaattcactcggctggagcct
gtctactcaccccctggcagccccccacctggggacccccgaatctttcagggatactcc
tttgtggcaccctccattctctttgaccacaacaacgcggtgatgaccgatgggctggaa
gcgcctggtgctggagaccggccaggtcgggcagcggtggccaggagcgctatgatgcag
gactcgcccttcttccagcagtacgagctggacctgcgggagcctgcgctgggccagggc
agcttttctgtgtgtcgccgctgccgccagcgccagagcggccaggagttcgcagtcaag
atcctcagtcgcaggctggaggcgaacacgcagcgcgaagtggctgccctgcgcctgtgc
cagtcacaccccaacgtggtgaatctgcacgaggtgcatcacgaccagctgcacacgtac
ctggtcctggagctgctgcggggcggggagctgctggagcacatccgcaagaagcggcac
ttcagcgagtcggaagcaagccagatcctgcgcagcctcgtgtcggccgtgagcttcatg
cacgaggaggcgggcgtggtgcaccgcgacctcaagccggagaacatcctgtacgccgac
gacacgcccggggccccggtgaaaatcatcgacttcgggttcgcgcggttgcggccgcag
agtcccggggtgcccatgcagacgccctgcttcacgctgcagtacgctgcccccgagctg
ctggcgcagcagggctacgacgagtcctgcgacctctggagcctgggcgtcattctgtac
atgatgctgtcggggcaggtccccttccagggggcctctggccagggcgggcagagccag
gcggccgagatcatgtgcaaaatccgcgaggggcgcttctcccttgacggggaggcctgg
cagggtgtatccgaggaagccaaggagctggtccgagggctcctgaccgtggaccccgcc
aagcggctgaagctcgagggactgcggggcagctcgtggctgcaggacggcagcgcgcgc
tcctcgcccccgctccggacgcccgacgtgctcgagtcctctgggcccgcagtgcgctcg
ggtctcaacgccaccttcatggcattcaaccggggcaagcgggagggcttcttcctgaag
agcgtggagaatgcacccctggccaagcggcggaagcagaagctgcggagcgccaccgcc
tcccgccggggctcccctgcaccagccaacccgggccgagcccccgtcgcctccaaaggg
gccccccgccgagccaacggccccctgcccccctcctaa

DBGET integrated database retrieval system