KEGG   Homo sapiens (human): 9409
Entry
9409              CDS       T01001                                 

Gene name
PEX16, PBD8A, PBD8B
Definition
(RefSeq) peroxisomal biogenesis factor 16
  KO
K13335  peroxin-16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    9409 (PEX16)
SSDB
Motif
Pfam: Pex16
Other DBs
NCBI-GeneID: 9409
NCBI-ProteinID: NP_004804
OMIM: 603360
HGNC: 8857
Ensembl: ENSG00000121680
Vega: OTTHUMG00000167005
Pharos: Q9Y5Y5(Tbio)
UniProt: Q9Y5Y5
LinkDB
Position
11p11.2
AA seq 336 aa
MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL
NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK
AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN
TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ
RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL
FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggagaagctgcggctcctgggcctccgctaccaggagtacgtgactcgtcacccggcc
gccacggcccagctggagacagcagtgcggggcttcagttacctgctggcaggtcgattc
gccgattcgcacgagctgtcagagctggtgtactctgcctctaacctgcttgtgctgctc
aatgacgggatcctacggaaggagcttcggaaaaagttgcctgtgtcgctgtcccagcag
aagctgctgacatggctgagcgtgctggagtgcgtggaggtgttcatggagatgggagct
gccaaggtgtggggtgaagtgggccgctggcttgtcatcgccctcgtccagctggccaag
gctgtactgcggatgctcctgctgctctggttcaaggctggcctccagacttcaccccct
atcgttccactggacagagagacccaggcacagcccccggatggtgaccacagccctggc
aaccatgagcagtcctacgtggggaagcggtcaaaccgggtggtgcgaaccctccagaac
acgccgtccctgcactccaggcactggggagctccccagcagcgggagggacggcagcag
cagcatcacgaggagctgagtgcgacccccacccccctggggctgcaggagaccatcgca
gagtttttgtacattgcccggccgctgctgcacttgctcagcctgggcctgtggggtcag
aggtcgtggaaaccctggctcttggctggtgttgtggacgtgaccagcctgagcctcctg
agtgacagaaagggcctgacccggagggagcggcgggagctgcggcgccggaccatcctg
ctgctctactacctgctgcgctctcctttctatgaccgcttctccgaggccaggatcctc
ttcctgctccagttgctggccgaccacgtccctggcgttggcctggtcacaaggccgctc
atggattacttgcccacctggcagaaaatctacttctacagttggggctga

DBGET integrated database retrieval system