KEGG   Homo sapiens (human): 9436
Entry
9436              CDS       T01001                                 

Gene name
NCR2, CD336, LY95, NK-p44, NKP44, dJ149M18.1
Definition
(RefSeq) natural cytotoxicity triggering receptor 2
  KO
K06742  natural cytotoxicity triggering receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    9436 (NCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    9436 (NCR2)
CD molecules [BR:hsa04090]
 Proteins
  9436 (NCR2)
SSDB
Motif
Pfam: V-set Ig_2 Ig_6 ig UPF0556
Other DBs
NCBI-GeneID: 9436
NCBI-ProteinID: NP_004819
OMIM: 604531
HGNC: 6732
Ensembl: ENSG00000096264
Vega: OTTHUMG00000014678
Pharos: O95944(Tbio)
UniProt: O95944
LinkDB
Structure
PDB: 
1HKF

Position
6p21.1
AA seq 276 aa
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASA
LVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS
KSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQN
STLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQ
VTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcctggcgagccctacacccactgctactgctgctgctgctgttcccaggctctcag
gcacaatccaaggctcaggtacttcaaagtgtggcagggcagacgctaaccgtgagatgc
cagtacccgcccacgggcagtctctacgagaagaaaggctggtgtaaggaggcttcagca
cttgtgtgcatcaggttagtcaccagctccaagcccaggacgatggcttggacctctcga
ttcacaatctgggacgaccctgatgctggcttcttcactgtcaccatgactgatctgaga
gaggaagactcaggacattactggtgtagaatctaccgcccttctgacaactctgtctct
aagtccgtcagattctatctggtggtatctccagcctctgcctccacacagacctcctgg
actccccgcgacctggtctcttcacagacccagacccagagctgtgtgcctcccactgca
ggagccagacaagcccctgagtctccatctaccatccctgtcccttcacagccacagaac
tccacgctccgccctggccctgcagcccccattgccctggtgcctgtgttctgtggactc
ctcgtagccaagagcctggtgctgtcagccctgctcgtctggtggggggacatatggtgg
aaaaccatgatggagctcaggagcctggatacccaaaaagccacctgccaccttcaacag
gtcacggaccttccctggacctcagtttcctcacctgtagagagagaaatattatatcac
actgttgcaaggactaagataagcgatgatgatgatgaacacactttgtga

DBGET integrated database retrieval system