KEGG   Homo sapiens (human): 949Help
Entry
949               CDS       T01001                                 

Gene name
SCARB1, CD36L1, CLA-1, CLA1, HDLQTL6, SR-BI, SRB1
Definition
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04913  Ovarian steroidogenesis
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa04975  Fat digestion and absorption
hsa04976  Bile secretion
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    949 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    949 (SCARB1)
   04925 Aldosterone synthesis and secretion
    949 (SCARB1)
   04927 Cortisol synthesis and secretion
    949 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    949 (SCARB1)
   04975 Fat digestion and absorption
    949 (SCARB1)
   04979 Cholesterol metabolism
    949 (SCARB1)
   04977 Vitamin digestion and absorption
    949 (SCARB1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    949 (SCARB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    949 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    949 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    949 (SCARB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    949 (SCARB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   949 (SCARB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36 PorA
Motif
Other DBs
NCBI-GeneID: 949
NCBI-ProteinID: NP_005496
OMIM: 601040
HGNC: 1664
Ensembl: ENSG00000073060
Vega: OTTHUMG00000168544
Pharos: Q8WTV0(Tchem)
UniProt: Q8WTV0 A0A024RBS4
LinkDB All DBs
Position
12q24.31
AA seq 509 aa AA seqDB search
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKG
SKDKEAIQAYSESLMTSAPKGSVLQEAKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctccgccaaagcgcgctgggctgccggggcgctgggcgtcgcggggctactg
tgcgctgtgctgggcgctgtcatgatcgtgatggtgccgtcgctcatcaagcagcaggtc
cttaagaacgtgcgcatcgaccccagtagcctgtccttcaacatgtggaaggagatccct
atccccttctatctctccgtctacttctttgacgtcatgaaccccagcgagatcctgaag
ggcgagaagccgcaggtgcgggagcgcgggccctacgtgtacagggagttcaggcacaaa
agcaacatcaccttcaacaacaacgacaccgtgtccttcctcgagtaccgcaccttccag
ttccagccctccaagtcccacggctcggagagcgactacatcgtcatgcccaacatcctg
gtcttgggtgcggcggtgatgatggagaataagcccatgaccctgaagctcatcatgacc
ttggcattcaccaccctcggcgaacgtgccttcatgaaccgcactgtgggtgagatcatg
tggggctacaaggacccccttgtgaatctcatcaacaagtactttccaggcatgttcccc
ttcaaggacaagttcggattatttgctgagctcaacaactccgactctgggctcttcacg
gtgttcacgggggtccagaacatcagcaggatccacctcgtggacaagtggaacgggctg
agcaaggttgacttctggcattccgatcagtgcaacatgatcaatggaacttctgggcaa
atgtggccgcccttcatgactcctgagtcctcgctggagttctacagcccggaggcctgc
cgatccatgaagctaatgtacaaggagtcaggggtgtttgaaggcatccccacctatcgc
ttcgtggctcccaaaaccctgtttgccaacgggtccatctacccacccaacgaaggcttc
tgcccgtgcctggagtctggaattcagaacgtcagcacctgcaggttcagtgcccccttg
tttctctcccatcctcacttcctcaacgctgacccggttctggcagaagcggtgactggc
ctgcaccctaaccaggaggcacactccttgttcctggacatccacccggtcacgggaatc
cccatgaactgctctgtgaaactgcagctgagcctctacatgaaatctgtcgcaggcatt
ggacaaactgggaagattgagcctgtggtcctgccgctgctctggtttgcagagagcggg
gccatggagggggagactcttcacacattctacactcagctggtgttgatgcccaaggtg
atgcactatgcccagtacgtcctcctggcgctgggctgcgtcctgctgctggtccctgtc
atctgccaaatccggagccaagagaaatgctatttattttggagtagtagtaaaaagggc
tcaaaggataaggaggccattcaggcctattctgaatccctgatgacatcagctcccaag
ggctctgtgctgcaggaagcaaaactgtag

DBGET integrated database retrieval system