KEGG   Homo sapiens (human): 9530Help
Entry
9530              CDS       T01001                                 

Gene name
BAG4, BAG-4, SODD
Definition
(RefSeq) BCL2 associated athanogene 4
  KO
K09558  BCL2-associated athanogene 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    9530 (BAG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9530 (BAG4)
   04131 Membrane trafficking [BR:hsa04131]
    9530 (BAG4)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9530 (BAG4)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    9530 (BAG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAG DUF2682 DMP12
Motif
Other DBs
NCBI-GeneID: 9530
NCBI-ProteinID: NP_004865
OMIM: 603884
HGNC: 940
Ensembl: ENSG00000156735
Vega: OTTHUMG00000164064
Pharos: O95429(Tbio)
UniProt: O95429
LinkDB All DBs
Structure
PDB: 

Position
8p11.23
AA seq 457 aa AA seqDB search
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAET
TWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVR
PELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSP
TPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQE
DAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPSSGSPQSPPSPPVQQPKDSSY
PYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQD
QSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccctgaggcgctcgggctacggccccagtgacggtccgtcctacggccgctac
tacgggcctgggggtggagatgtgccggtacacccacctccacccttatatcctcttcgc
cctgaacctccccagcctcccatttcctggcgggtgcgcgggggcggcccggcggagacc
acctggctgggagaaggcggaggaggcgatggctactatccctcgggaggcgcctggcca
gagcctggtcgagccggaggaagccaccaggagcagccaccatatcctagctacaattct
aactattggaattctactgcgagatctagggctccttacccaagtacatatcctgtaaga
ccagaattgcaaggccagagtttgaattcttatacaaatggagcgtatggtccaacatac
cccccaggccctggggcaaatactgcctcatactcaggggcttattatgcacctggttat
actcagaccagttactccacagaagttccaagtacttaccgttcatctggcaacagccca
actccagtctctcgttggatctatccccagcaggactgtcagactgaagcaccccctctt
agggggcaggttccaggatatccgccttcacagaaccctggaatgaccctgccccattat
ccttatggagatggtaatcgtagtgttccacaatcaggaccgactgtacgaccacaagaa
gatgcgtgggcttctcctggtgcttatggaatgggtggccgttatccctggccttcatca
gcgccctcagcaccacccggcaatctctacatgactgaaagtacttcaccatggcctagc
agtggctctccccagtcacccccttcacccccagtccagcagcccaaggattcttcatac
ccctatagccaatcagatcaaagcatgaaccggcacaactttccttgcagtgtccatcag
tacgaatcctcggggacagtgaacaatgatgattcagatcttttggattcccaagtccag
tatagtgctgagcctcagctgtatggtaatgccaccagtgaccatcccaacaatcaagat
caaagtagcagtcttcctgaagaatgtgtaccttcagatgaaagtactcctccgagtatt
aaaaaaatcatacatgtgctggagaaggtccagtatcttgaacaagaagtagaagaattt
gtaggaaaaaagacagacaaagcatactggcttctggaagaaatgctaaccaaggaactt
ttggaactggattcagttgaaactgggggccaggactctgtacggcaggccagaaaagag
gctgtttgtaagattcaggccatactggaaaaattagaaaaaaaaggattatga

DBGET integrated database retrieval system