KEGG   Homo sapiens (human): 9815
Entry
9815              CDS       T01001                                 

Gene name
GIT2, CAT-2, CAT2, PKL
Definition
(RefSeq) GIT ArfGAP 2
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01070  ITGA/B-FAK-CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9815 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    9815 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9815 (GIT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9815 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9815 (GIT2)
SSDB
Motif
Pfam: GIT1_C ArfGap GIT_CC GIT_SHD Ank_2 Ank_5 Ank_4 Ank Shugoshin_N TTRAP DMPK_coil Sen15 T7SS_ESX_EspC YabA
Other DBs
NCBI-GeneID: 9815
NCBI-ProteinID: NP_476510
OMIM: 608564
HGNC: 4273
Ensembl: ENSG00000139436
Vega: OTTHUMG00000169313
Pharos: Q14161(Tbio)
UniProt: Q14161
LinkDB
Position
12q24.11
AA seq 759 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtcgaaacggctccggagcagcgaggtgtgcgctgactgcagcgggccggatccttcc
tgggcatcagtaaataggggaacgtttttatgtgatgagtgctgcagtgtccatcggagt
ctagggcgccatatctcccaagtgaggcatctgaaacacacaccgtggcctccaacactg
cttcagatggttgagaccttgtataataacggtgctaactctatatgggagcattctttg
ctggaccctgcgtctattatgagtggaagacgtaaagctaatccacaggataaagtacat
cccaataaagcggaattcatcagagccaagtatcagatgttagcgttcgtccatcgcttg
ccctgccgggatgacgatagtgtgactgccaaagatcttagcaagcaactccattcgagc
gtgagaacagggaatcttgaaacctgtttgagactgttatctttaggagcacaagccaac
ttctttcatcctgaaaaaggaaacaccccactccatgttgcctccaaagcagggcagatt
ttacaggctgaattattggcagtatatggagcagacccaggcacacaggattctagtggg
aaaactcccgttgattatgcaaggcaaggagggcaccatgagctggcagagcgcctcgtg
gaaatacagtatgagctaacggacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagcagcctggatttgtct
gaattggcaaaagctgctaagaagaaacttcaatctctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagacggatgcagtctggcttgcc
acgcaaaaccacagcgccctggtaaccgagacaacggtcgtcccctttcttccggtcaat
cctgagtactcatcaacacgaaatcagggcagacagaagttagctcggttcaacgcccat
gagtttgccacgctggtcattgacattctcagtgacgccaagaggagacagcagggcagt
tctctctcgggttcaaaagacaatgtggagctcatactgaaaaccatcaataaccagcac
agcgttgagagtcaagacaacgatcagcccgactatgacagcgtggcatcagacgaagac
acagatttggaaaccactgcaagcaaaacaaaccggcagaagagcctagattcagattta
tcagatggaccagtcactgtacaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacagcagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacaggccaca
accaatgtatatcaggtgcaaactggttctgagtacacagacacttccaaccactcttcc
ttaaagagacgtccgtctgcccggggcagtaggcccatgtccatgtacgagaccggatca
ggtcagaaaccatatctcccaatgggagaagcgagccgccccgaagagagcaggatgaga
ctccagcccttccccgcgcacatcgggaggagtgcacttgtgacctcctcttcatctctg
ccttccttcccctccacactttcctggtcgagggacgaaagcgcccgaagggcatccagg
ctggagaagcagaacagcacacctgagagtgactacgacaacactcccaacgacatggag
ccagatggcatggggtcaagccgaaagggacggcaaagaagtatggtgtggccaggggat
ggcttggtaccagacacagcagaaccccatgtggccccaagccccactctccctagcacc
gaagatgtcatcaggaagactgaacagatcaccaaaaacatacaggagctcttaagagca
gcccaagaaaataaacatgacagttatattccctgctcagagaggatacacgtagctgtt
acagaaatggcagcattattccccaaaaaacccaagtctgatatggtgaggacttccctt
cgtttactgacgtccagtgcctaccgactgcagtcagagtgcaagaagaccctcccaggg
gaccccggctcacccacagacgttcagctggtcacgcagcaggtcatccagtgtgcgtac
gacatcgccaaggctgccaagcagctggttaccatcaccaccaaagagaacaacaactga

DBGET integrated database retrieval system