KEGG   Ictalurus punctatus (channel catfish): 108270425Help
Entry
108270425         CDS       T04658                                 

Definition
(RefSeq) ALK tyrosine kinase receptor-like
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108270425
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ipu04090]
    108270425
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108270425
Protein kinases [BR:ipu01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   108270425
CD molecules [BR:ipu04090]
 Proteins
  108270425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Gly_rich MAM Ldl_recept_a DDHD Pkinase_fungal PRCC APH
Motif
Other DBs
NCBI-GeneID: 108270425
NCBI-ProteinID: XP_017332605
UniProt: A0A2D0RRM2
LinkDB All DBs
Position
9
AA seq 1404 aa AA seqDB search
MCDTEKEPKMAEGAGLVSESQASPSASSPKMSGLNRGEEEGYSGPALTLNSSTSVLRQPF
CLLMMLILLVLSLLGSWAVVHLSLGARETPFRISSSYDQPGELETATYNPFFITNCTMET
SRNVTFEGRYHCRQGQEISLERLCDFTPDCAQGDDEGEPCRQFLNGSYCSFEEDDCGWQM
VSSKSLYKGVHLSLPKRLTNSCPSSGSVLALESQSKGQRGSVAVRSPLFLYPLRNAPCMV
RFQVCGSPNGLLSLWIIENSTGPESQKSLWNSSSETKQDKGWQLVTFPLFGLVDSFYLQF
TADISSGSEVAFAVDNFTLTMNCFLETNGEFPPVVPTSFTPMPFRPTNHVKTTPVVPTNT
KWLFHTCGATGPIGPTPSLCSSSYRKSNVNVTVGTKGVLKGIQMWRVPETGLYRITAYGA
AGGRSVLNMFRSHGVYIAGDFRLHKDDMLYILVGQQGEDACPRTEEPLQKICLEQKGPPD
SKSMLKGGGGGGGGATYIFKVDKSVYIPLLIAAGGGGRGYNGHSESSMELMDHGFSVPGL
NGMSGAAGGGGGWNDSAPVSRGGRPLNLGGQGGAPCHTMGWKTNGGFGGGGGACTSGGGG
GGYRGGSTSVDNDPEQDGEDGSSFISPDGKIFMDALKGMEGDGEVIIKPVQNCSHCESGE
CYETLEGTECYCDNDLVLASDNVSCINSTVPDTSVPLQPSLSHLALALSVGTSALIAALL
LAVSGVMIMYRRKHTELQSIQLELQSPDCKLSKLRASTIMTDYNPNYCFAGKTASVNDLK
EVPRRNISLTRGLGHGAFGEVYEGLAVGIPGEPSPMQVAVKTLPEVCSEQDELDFLMEAL
IISKFSHQNIVRCIGVSLQALPRFILLELMAGGDLKTFLRETRPRLEHPSSLTMVDLLNI
ARDIARGCQYLEENQFIHRDIAARNCLLTCKGPGRVAKIGDFGMARDIYRASYYRKGGRA
MLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSMGYMPYPSRSNQEVLDFVTNGGRMD
PPKNCPGPVYRIMTQSWQHQPEDRPNFSTILERIDYCLQDPDVVNVPLPVEYGPIPEEEE
RVPMHPDDPAAPSLLAAPQGIEETSSSTTETRSEEAKRAAEALLMNARSSDNKPVPGTAS
QLHSHPPVSSASALLACSKSASVVPAPQDGGHVNLGFAQAPTGEKENRNGKPTNLWNPTY
GSWFLQQQQKRQQAQAQRQAGNQGHELSGRTGSIADALGLQHQHKQQQMQIQQQQKIQIQ
QQQQQKLQQQQQQIQQQQKIQQQQQIQIQQQQQGKCRPLLPPPPQPAPAPLLLDSAALPP
VPLYRLRRFPCGNIGYGYQEQGLPLESMSGPQNAVPPPALANQQRPNSLGWTGTAEDSRP
LLVTMGTVQDSRLPKMDGHNATVL
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacactgaaaaagagcctaaaatggcagagggagcaggtttggtgtcagaaagc
caagcttcaccctctgccagctccccaaaaatgagtgggctgaaccggggagaagaagaa
gggtactcagggcctgctctgaccctgaacagctctacttcggttcttcgacaacctttc
tgcctgctcatgatgctgatcttgctggttttgtctctccttggcagctgggcggtggtg
cacctcagcttgggagctcgggaaacaccgttcaggatctcatccagttacgaccagcct
ggagagctagagacagctacctacaacccgttcttcattaccaactgcaccatggagacc
tctcgaaacgtgacctttgagggccgctaccactgcagacagggtcaggagatcagtctg
gaacgcctgtgtgacttcactcctgattgtgctcaaggggacgatgaaggagagccatgc
cgtcagtttcttaacggaagctactgctcttttgaagaggacgactgtgggtggcagatg
gtgtcaagtaaaagtttgtacaaaggagtccatctttctctgcctaaaagacttacaaac
agctgcccatcctcgggttctgttttggctctggaaagtcaatccaaaggccaacggggg
tcagtagctgtgcggagtccactgttcctctaccccctgcgcaacgccccatgcatggta
cgtttccaggtatgtggaagcccaaatggtcttctttctctctggatcatcgaaaacagc
acaggacccgaaagccaaaaaagtctatggaactccagcagtgagaccaaacaggacaag
ggatggcaactcgtcactttcccactgtttggattagtcgactcgttctatctccagttc
acagcagacatttcttctggctctgaagtggcgtttgctgtggataacttcactcttact
atgaactgtttccttgaaactaatggagaattcccaccagtggttccgacaagttttact
ccaatgccgttcagaccgactaatcatgtgaagacgacaccagtagtgcctacaaacacc
aagtggttattccacacctgtggggctacagggccaattggtcctactccttctctgtgt
agcagttcctaccgtaaaagcaatgtgaatgtgaccgtggggacaaagggagtactcaag
ggcatccagatgtggagggttcctgaaactggattatacaggatcacggcttatggtgcg
gcaggtggtcgcagtgttctcaacatgttcagatcacatggagtctatattgctggagat
tttaggcttcacaaagatgatatgctgtacatcctggtgggacaacagggagaagacgcc
tgtcctagaactgaggagcctctgcagaagatctgtcttgagcagaaaggccctccagac
agcaagagcatgttgaagggaggaggtggaggaggagggggtgctacctacatctttaaa
gtggacaagtcagtttatattcctctgctaattgctgctggaggtgggggtcgaggttac
aacggccattcagagagctcgatggagctgatggaccatggtttcagtgttcctggtctc
aatggcatgtcaggagcagcaggtggaggtggaggttggaatgatagcgcacctgtgtct
cggggtgggagacccctcaatttgggaggtcagggaggagctccatgccatacgatgggc
tggaagactaatggcggcttcggaggaggtggaggagcttgcactagtgggggtggagga
ggtggctatagaggtggcagcacttcagtagacaatgaccctgagcaggatggagaggac
ggatcctcctttatcagcccagatggaaagatattcatggatgcacttaaaggcatggag
ggcgatggtgaggtgatcatcaaaccagtgcagaactgcagtcactgcgagtcaggagag
tgctatgagacattggagggaacagagtgttactgcgacaatgatcttgtacttgcctca
gacaatgtctcctgtatcaattctacagttccagatacatcggtgccccttcagccctct
ctctctcacctggcattggcgctctctgtaggaacctcagcactcattgcagctctgttg
ctagcagtgtctggagtgatgatcatgtacaggcgcaagcacactgagctgcagtccatt
cagctggagcttcagagtccagactgcaagctgagtaagctgagagcatcaaccatcatg
actgattacaaccccaactactgcttcgctggaaagacggcctctgttaatgaccttaag
gaagtaccacgccgcaacatttcgctcacaaggggtttggggcatggagcctttggagag
gtctatgagggtctggctgtgggaataccaggagaacccagtcccatgcaggtagctgtc
aagacacttcctgaggtgtgctctgagcaggatgaactagactttctgatggaagcactc
ataatcagtaaattcagccatcagaacattgtccgatgtataggagtgagtttacaggct
cttcctcgattcattttgctggagctgatggctggaggagacctcaaaacatttcttagg
gagactagacccaggctggagcatccttccagtctgactatggtggaccttctgaacata
gccagagatatagcacgtggctgccagtacctagaagagaatcagttcattcacagggac
attgctgcgagaaactgcttactcacctgtaaaggtccaggaagagtggccaaaatcgga
gacttcggcatggccagagacatctacagagccagctactacaggaaaggaggccgtgct
atgctgccagttaaatggatgcctccagaggcctttatggaaggaatatttacctccaaa
actgatacatggtcttttggagtgctgctgtgggaaatcttctcaatgggatatatgcca
taccccagccgtagtaatcaggaggttctggatttcgtcactaatggaggcaggatggat
cctccaaaaaactgcccaggaccagtctatcggataatgacgcagagctggcaacaccaa
cctgaagacaggccaaacttttccactatcctcgagcggattgactattgtttgcaggat
ccagatgtggtaaacgtacctttacctgttgagtatggcccaattcctgaggaggaagag
cgcgtgcccatgcatccagatgaccctgctgcaccctctttactagccgccccccagggc
atagaggaaacatcatcttccaccactgagacccgctcagaggaggccaagagagctgct
gaggctctcttgatgaatgctcgctcatctgacaacaaacctgtacccggtactgcctcc
cagctccactcccatccgccagtgtcctcggcatctgcgctgctggcctgcagcaagtcc
gcctctgttgtccctgctccccaggatggaggccatgtcaacctgggttttgctcaggct
cctacaggtgagaaggagaaccgtaatgggaagcccaccaacttgtggaatcctacatat
ggttcatggtttctccagcaacaacaaaagaggcagcaggcccaggcacagaggcaggca
ggaaatcaaggccatgagctctctggcaggactgggagtatcgctgatgctctgggcctg
cagcaccagcacaagcaacagcagatgcagatccagcagcaacaaaagatacagatccag
cagcagcaacagcagaaacttcaacagcagcaacaacagatccagcagcagcaaaaaata
cagcaacaacaacaaattcagatccagcaacagcaacaggggaagtgcaggcctctcttg
ccccctcctccccaacctgccccagcccctctgttgctggattcagcagccctgccccct
gtaccactctacagactgcgccgcttcccttgcggcaacattgggtatggctaccaggag
cagggtctgcctttggaatcaatgtctggaccccagaatgccgtgccacctcctgccctc
gccaaccagcagagacccaactcactaggctggactggcaccgctgaggacagccgtccc
ctgctggtgacaatgggaacagttcaggactccagactccctaagatggatgggcacaat
gccacagtgctttaa

DBGET integrated database retrieval system