KEGG   Juglans regia (English walnut): 108992364Help
Entry
108992364         CDS       T05245                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00904  Diterpenoid biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    108992364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:jre00199]
    108992364
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     108992364
Cytochrome P450 [BR:jre00199]
 Cytochrome P450, plant type
  CYP701 family
   108992364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108992364
NCBI-ProteinID: XP_018822462
UniProt: A0A2I4EST4
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MSMASLTHILKDIQAAAPLSTSVALGSLSLLLFFLIIRGFFSNQKMGSSTLPPAPVVPGL
PVIGNLLQLKEKKPHKTFARWAEIYGPIYSIKTGASTVVVLNSTDVAKEAMVTRHSSIST
RNLTKALTILTSDKCMVATSDYNEFHKMVKRHILANVLGPNAQKRHQRHRVTMIENVSSK
FHALIKKSPLEAVKFRKVFESELFGLALKEALGHDVQSIYVEELGSTLSREEIFKILVTE
LMEGAIEVDWRDFFPYLKWIPNESFEKKIKRVAFRRKVVMKALIKEQTERFASGEEVDCY
VSYLLSEAKTLTNEQIAMLVWEAIIETSDTTLVTTEWALYELAKSPIHQDRLYQQIQNVC
GSGKFAEEHLSQLPYLSAVFHETLRKHSPVPIVPLRYAHEDTQLGGYFIPAGSEIAINIY
GCNMDKKQWENPEEWKPERFLDEKYDPTDMYKTMAFGGGKRVCAGSLQANLIACTSIGRL
VQEFEWRLNDGEEDNVDTLGLTTHKLHPMQAMLKLRN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggccagcctaactcatatccttaaagatatccaagctgctgcgcccctttcc
acatctgttgctcttggtagtctctctcttttgcttttctttctgatcatccgaggattt
ttctccaaccaaaagatgggaagttccacactccctccggcacccgttgttccagggctt
ccggttattggaaacttgctgcagctgaaggagaagaaaccccacaagacatttgcaagg
tgggctgagatatatggtccaatctattccatcaaaactggtgcttctactgttgttgtt
ctcaattcaacagatgttgccaaagaggctatggtgaccagacattcatccatctcaaca
agaaatttaacgaaagccctaacgattctcacgtcggataaatgtatggtagcaacgagt
gactacaatgagtttcacaagatggtaaagcgacatatacttgcaaatgttctgggaccg
aatgctcagaagcggcatcaacgccacagagttaccatgatagaaaatgtatcaagcaaa
tttcatgctcttataaagaagtctcccctcgaagctgtgaagttcaggaaagtttttgag
tctgaactttttggactagcattgaaagaagctttaggacatgacgtgcaatccatttat
gtagaggagcttgggagcactttgtcaagagaggagatatttaagattctagtaaccgaa
ttaatggagggtgcaattgaggtggattggagagatttcttcccatacctgaaatggatt
ccaaatgagagcttcgagaagaaaattaagcgagttgcttttcgcaggaaagtagtgatg
aaggccctaatcaaggagcagacggagcgcttcgcttcaggagaggaagtagattgttat
gtcagctacttgttatctgaggcaaaaacacttaccaatgaacaaattgccatgttggtt
tgggaggcgatcatcgagacatcagatactactttggttactaccgagtgggccttgtat
gaactagctaaaagtccaattcatcaggatcgtctttaccaacagatccaaaatgtttgt
ggatctggaaagtttgctgaggaacatttgtctcagcttccatacctgagtgctgttttc
catgaaactttgaggaagcacagcccagttccaatagtgcccttgcgatatgcacatgaa
gacacccaattaggagggtactttattccggctggaagtgagattgcaataaacatatac
ggatgtaacatggacaagaaacaatgggaaaatccggaagagtggaagccggagaggttt
ctcgatgagaaatatgacccaacggatatgtacaagacgatggcattcggaggaggaaag
agagtatgcgcgggttctcttcaggcaaacctaatagcatgcacatcaattggtcggtta
gtacaggagtttgagtggaggctgaatgatggggaggaggacaatgtggatactcttggg
ctcactactcacaaactccatccgatgcaagcaatgttaaagctgagaaattaa

DBGET integrated database retrieval system