KEGG   Loxodonta africana (African savanna elephant): 100653700
Entry
100653700         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100653700
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100653700
   04145 Phagosome
    100653700
  09143 Cell growth and death
   04218 Cellular senescence
    100653700
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100653700
   04612 Antigen processing and presentation
    100653700
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100653700
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100653700
   05330 Allograft rejection
    100653700
   05332 Graft-versus-host disease
    100653700
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100653700
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100653700
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100653700
   05170 Human immunodeficiency virus 1 infection
    100653700
   05168 Herpes simplex virus 1 infection
    100653700
   05163 Human cytomegalovirus infection
    100653700
   05167 Kaposi sarcoma-associated herpesvirus infection
    100653700
   05169 Epstein-Barr virus infection
    100653700
   05165 Human papillomavirus infection
    100653700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100653700
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100653700
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100653700
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100653700
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 MHC_I_3 ig Ig_2 LapA_dom PTP_tm
Other DBs
NCBI-GeneID: 100653700
NCBI-ProteinID: XP_010599501
LinkDB
Position
Unknown
AA seq 316 aa
MAPRTLLLLLSGALALTQTRAGSHTIQLMYGCEVGPDGRLLHGYHQYAYDGADYLALNED
LSSWTAADSAAQISKGKFENRGEAEYRRAYLEGACLQWLGKYLENGKETLQRVDPPKTHM
THHHISDREATLRCWALGFYPAEITLTWQRDGEDQTQDMELVETRPAGDGTFQKWAALMV
PSGEEQRYTCRVQHEGLSEPVTLRWELSSQASTPIIGVVAGLLLLGAVVLGVVVAGAVVM
WRKKNSGGKGGSYTQAASSDSAQGSDVSLTASKGESLGGLTWRRGLDREGMTGSWGFFEF
GHFDHVLGSSGFQQLQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcgccccggaccctcctcctgctgctctcgggggccctggccctgacccagacccgg
gcggggtctcacactatccagttgatgtacggctgtgaagtgggtcccgacgggcgcctc
ctccacgggtaccatcagtatgcctacgacggcgccgattacctggccctgaacgaggac
ttgagctcctggacggcggcggactcggcagctcagatctcaaagggcaaattcgagaat
cgcggggaggcggagtatcggagggcctacctggagggcgcatgcctgcagtggctgggc
aaatacctggagaacgggaaggagacgctgcagcgagtagaccccccaaagacacacatg
acccaccaccacatctctgaccgtgaggccacgctgagatgttgggccctgggcttctac
ccggcggagatcaccctgacctggcagcgggatggggaggaccagacccaggacatggag
cttgtggagacccggcctgcaggagacgggacgttccagaagtgggcagccctgatggtg
ccctctggagaggaacagagatacacatgccgggtgcagcatgaggggctgtctgagcct
gtcaccctgcgatgggaactgtcttcccaggccagcacccccatcataggggtcgttgct
ggcctccttctgcttggagctgtggtccttggagttgtggtggctggagctgttgtgatg
tggaggaagaagaactcaggtgggaaaggagggagctacactcaagctgcaagcagcgac
agtgcccagggctctgatgtgtcgctcacagcttctaaaggtgagagcctaggaggcctg
acatggaggaggggtttggatagagagggcatgactgggtcatggggattctttgaattt
ggacattttgatcatgtgttgggctcttcagggtttcaacagttacagtga

KEGG   Loxodonta africana (African savanna elephant): 100655144
Entry
100655144         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-37 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100655144
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100655144
   04145 Phagosome
    100655144
  09143 Cell growth and death
   04218 Cellular senescence
    100655144
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100655144
   04612 Antigen processing and presentation
    100655144
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100655144
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100655144
   05330 Allograft rejection
    100655144
   05332 Graft-versus-host disease
    100655144
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100655144
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100655144
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655144
   05170 Human immunodeficiency virus 1 infection
    100655144
   05168 Herpes simplex virus 1 infection
    100655144
   05163 Human cytomegalovirus infection
    100655144
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655144
   05169 Epstein-Barr virus infection
    100655144
   05165 Human papillomavirus infection
    100655144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100655144
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100655144
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100655144
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100655144
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 MHC_I_3 ig PRIMA1 EphA2_TM Ig_2 DUF4834
Other DBs
NCBI-GeneID: 100655144
NCBI-ProteinID: XP_003423760
LinkDB
Position
Unknown
AA seq 273 aa
MAASVGGGGGADGGAGLTAGAGSGSHTIQRMSGCEVGPDGRLLRGYQQHAYDGADYIALN
EDLSSWTAADTAAQITQRKWEAEKAADRIRAYVEGRCQEYLRRYLENGKESLQRADPPKA
HITHHPISDREATLRCWALSFYPAEITLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAM
VVPSGEEQRYTCHVQHEGLPKPLTLTWESRSQSPAIIVVIIAGLVFLVVVVALVARAVIW
RKKSSGGKGGNYAQAASNNSAQGSDVSLMACKA
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcggccagtgtgggtggcgggggcggggctgacggcggggcggggctgacggcgggg
gcggggtcagggtctcacaccatccagaggatgtccggctgtgaagtggggcccgacggg
cgcctcctccgtggctaccagcagcacgcctatgacggcgccgactacatcgccctgaac
gaggacctgagctcctggaccgcggcggacacggccgctcagatcacccagcgcaagtgg
gaggctgagaaggctgcagatcggatcagggcctacgtggagggcaggtgccaggagtac
ctccgcagatacctggagaacgggaaggaatctctgcagcgcgcagacccccccaaagca
cacataacccaccaccccatctctgaccgtgaggccacgctgcggtgctgggccctgagc
ttctatcctgcggagatcaccctgacctggcagcgagatggagaggaccagacccaggac
atggagcttgtggagaccaggcctgcaggggacggaaccttccagaagtgggcagccatg
gtggtgccctctggagaggagcagagatacacgtgccatgtgcagcatgaggggctgccc
aagcctctcaccctgacatgggagtcccgttctcagtcccctgccatcatcgtggttatc
attgctggcctggtattccttgtggtcgttgtagctctggtggctagagctgtgatctgg
aggaagaagagctcaggtggaaaaggagggaactatgctcaggctgcaagtaacaacagt
gcccagggctctgatgtgtctctcatggcttgtaaagcatga

KEGG   Loxodonta africana (African savanna elephant): 100656828
Entry
100656828         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-67 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100656828
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100656828
   04145 Phagosome
    100656828
  09143 Cell growth and death
   04218 Cellular senescence
    100656828
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100656828
   04612 Antigen processing and presentation
    100656828
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100656828
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100656828
   05330 Allograft rejection
    100656828
   05332 Graft-versus-host disease
    100656828
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100656828
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100656828
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656828
   05170 Human immunodeficiency virus 1 infection
    100656828
   05168 Herpes simplex virus 1 infection
    100656828
   05163 Human cytomegalovirus infection
    100656828
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656828
   05169 Epstein-Barr virus infection
    100656828
   05165 Human papillomavirus infection
    100656828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100656828
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100656828
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100656828
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100656828
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C MHC_I_3 C2-set_2 Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 100656828
NCBI-ProteinID: XP_010599487
LinkDB
Position
Unknown
AA seq 364 aa
MAPRTLLLLLSGALALTQTGAGSHSLRYFDTTVSRPGRGEPRYISVGYVDDTQFVRFDSD
AANPRMEPRAPWIGQEGPEYWDRNTQIAKDSAQTSRESLRTALGYYNQSDAGSHTIQLMY
GCEVSPDGRLLHGYHQYAYDGADYLALNEDLRSWTAADRAAQMSKRKFENRGVAERWRAY
LEGTCLQWLGKYLENGKETLQRVDPPKTHMTHHRISDREATLRCWALGFYPAEITLTWQR
DGEDQTQDMELVETRPAGDGTFQKWAALVVPTGEEQKYTCRVQHEGLSEPVTLRWELSSQ
ASTPNIGVVAGLLLLGALVLGVVVAGAVWMWRKKNSGGKGGSYTQGSSSNSDQGSDVSLT
ASKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgccccggaccctcctcctgctgctctcgggggccctggccctgacccagaccggg
gcgggctcccactccctgcggtatttcgacaccaccgtgtcccggcccggccgcggggag
ccccggtacatctccgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gccgcgaacccgaggatggagccgcgggcaccgtggattgggcaggaagggccggagtat
tgggatcggaacacacagatcgccaaggacagcgcacagacttcccgagagagcctgcgg
accgcgctcggctactacaaccagagcgacgccgggtctcacaccatccagttgatgtac
ggctgtgaagtgagtcccgacgggcgcctcctccacgggtaccatcagtatgcctacgac
ggcgccgattatctggccctgaacgaggacctgcgctcctggacggcggcagacagggca
gctcagatgtcaaagcgaaaattcgagaatcgcggggtggcggagcgttggagggcctac
ctggagggcacatgcctgcagtggctgggcaaatacctggagaacgggaaggagacgctg
cagcgagtagaccccccaaagacacacatgacccaccaccgcatctctgaccgtgaggcc
acactgaggtgttgggccctgggcttctacccggcggagatcaccctgacctggcagcgg
gatggggaggaccagacccaggacatggagcttgtggagacccggcctgcgggagacggg
acattccagaagtgggcagccctggtggtccccactggagaggaacagaaatacacatgc
cgtgtgcagcatgaggggctgtctgagcctgtcaccctgcgatgggaactgtcttcccag
gccagcacccccaacataggggtcgttgctggcctccttctccttggagctctggtcctt
ggagttgtggtggctggagctgtttggatgtggaggaagaagaactcaggtgggaaagga
gggagctacactcaaggttcaagcagcaacagtgaccagggctcagatgtgtctctcaca
gcttctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100657492
Entry
100657492         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like isoform X2
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100657492
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100657492
   04145 Phagosome
    100657492
  09143 Cell growth and death
   04218 Cellular senescence
    100657492
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100657492
   04612 Antigen processing and presentation
    100657492
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100657492
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100657492
   05330 Allograft rejection
    100657492
   05332 Graft-versus-host disease
    100657492
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100657492
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100657492
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657492
   05170 Human immunodeficiency virus 1 infection
    100657492
   05168 Herpes simplex virus 1 infection
    100657492
   05163 Human cytomegalovirus infection
    100657492
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657492
   05169 Epstein-Barr virus infection
    100657492
   05165 Human papillomavirus infection
    100657492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100657492
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100657492
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100657492
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100657492
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 Ig_2 ig Darcynin LapA_dom PTP_tm
Other DBs
NCBI-GeneID: 100657492
NCBI-ProteinID: XP_010599502
LinkDB
Position
Unknown
AA seq 364 aa
MAPRTLLLLLSGALALTQTGAGSHSLRYFHTAVSRPGRGEPRFISVGYVDDTEFVWFDSD
AANPRMEPRAPWIEQEGPEYWDQETQNAKVTAQNYRVNLRTLRGYYNQSDAGSHTLQRMY
GCEVGPDRRLLRGYLQFAYDGADYLALNEDLSSWTAADRAAQISKGKFEKGGEAEYRRAY
LEGSCVQWLGKYLEKGKETLQRVDPPKTLITHHRISDRETTLRCWALGFYPAEITLTWQW
DGEDQTQDMELVETRPAGDGTFQKWAALVVPSGEEQRYTCRVQHEGLSEPVTLRWELSSQ
ASTPIIGVVAGLLLLGAVVLGVVVAGAVVMWRKKNSGGKGGSYTQAASSDSAQGSDVSLV
ASKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgccccggaccctcctcctgctgctctcgggggccctggccctgacccagaccggg
gcgggctcccactccctgagatattttcacaccgccgtgtcccggcccggccgcggagag
ccccgcttcatctccgtcggctacgtggacgacacggagttcgtgtggttcgacagcgac
gccgcgaacccgaggatggagccgcgggcgccgtggatcgagcaggaggggccggagtat
tgggaccaggagacacagaacgccaaggtcaccgctcagaactaccgagtgaacctgcgg
accctgcgcggctactacaaccagagcgacgccgggtctcacaccctccagaggatgtat
ggctgtgaagtgggtcccgacaggcgacttctccgcgggtaccttcagtttgcctacgac
ggcgccgattatctggccctgaacgaggacttgagctcctggactgcggcggacagggca
gctcagatctcaaagggcaaattcgagaagggcggggaggcggagtatcggagggcctac
ctggagggctcatgcgtgcagtggctcggcaaatacctggagaaggggaaggagacgctg
cagcgggtagaccccccaaagacactcataacccaccaccgcatatctgaccgtgagacc
acattgaggtgttgggccctgggcttctacccagcggagatcaccctgacctggcagtgg
gatggggaggaccagacccaggacatggagcttgtagagacccggcctgcaggagacggg
acgttccagaagtgggcagccctggtggtgccctctggagaggaacagagatacacatgc
cgtgtgcagcatgaggggctgtctgagcctgtgaccctgcgatgggaactgtcttcccag
gccagcacccccatcataggggtcgttgctggcctccttctgcttggagctgtggtcctt
ggagttgtggtggctggagctgttgtgatgtggaggaagaagaactcaggtgggaaagga
gggagctacactcaagctgcaagcagcgacagtgcccagggctctgatgtgtctctcgta
gcttctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100659386
Entry
100659386         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-39 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100659386
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100659386
   04145 Phagosome
    100659386
  09143 Cell growth and death
   04218 Cellular senescence
    100659386
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100659386
   04612 Antigen processing and presentation
    100659386
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100659386
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100659386
   05330 Allograft rejection
    100659386
   05332 Graft-versus-host disease
    100659386
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100659386
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100659386
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100659386
   05170 Human immunodeficiency virus 1 infection
    100659386
   05168 Herpes simplex virus 1 infection
    100659386
   05163 Human cytomegalovirus infection
    100659386
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659386
   05169 Epstein-Barr virus infection
    100659386
   05165 Human papillomavirus infection
    100659386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659386
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100659386
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100659386
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100659386
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 MHC_I_3 ig Adeno_E3_CR2 Ig_2 Ferric_reduct
Other DBs
NCBI-GeneID: 100659386
NCBI-ProteinID: XP_023396632
LinkDB
Position
Unknown
AA seq 356 aa
MAPRTLLLLLLGALALTQTRAGSHSLRYFSTAVSRPGRGEPRYISVGYVDDTQFVRFDSD
AANPREEPRAPWMEQEGPEYWDQETQISKGNTQTSRVNLRTLRGYYNQSDAGSHTIQRMY
GCEVGPDGRLLRGYEQHAYDGADYIALNEDLSSWTAADTAAQITRHKWEAEKVADRIRAY
VEGRCQEYLRRYLENGKESLQRADPPKAHVTHHPISDREATLRCWALGFYPAEITLTWKR
DGEDQTQDMELVETRPAGDGNFQKWAAVVVPSGEEQRYTCHVQHEGLSKPLTLRWESRSQ
FPAIITGVITALVLLVVVMLAGAAIWKKMSSGGKGRKYAQAASSNSAQGSDTSLMA
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgccccggaccctcctcctgctgctcttgggggccctggccctgacccagacccgg
gcgggctcccactccctgaggtatttcagcaccgccgtgtcccggcccggccgcggggag
ccccggtacatctccgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gccgcgaacccaagggaggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggaccaggagacacagatctcgaagggcaacacacagacttcccgagtgaacctgcgg
accctgcgcggctactacaaccagagcgacgccgggtctcacaccatccagaggatgtac
ggctgtgaagtggggcccgatggacgcctcctccgtggctatgagcagcacgcctatgac
ggcgccgactacatcgccctgaacgaggacctgagctcctggaccgcggcggacacggcc
gctcagatcacccggcacaagtgggaggctgagaaggttgcagatcggatcagggcctac
gtagagggcaggtgccaggagtacctccgaagatacctggagaacgggaaggaatctctg
cagcgcgcagacccccccaaagcacatgtaacccaccaccccatctctgaccgtgaggcc
acgctgaggtgctgggccctgggcttctaccctgcggagatcaccctgacctggaagcgg
gacggagaggaccagacccaggacatggagcttgtggagaccaggcctgcaggggacgga
aacttccagaaatgggcagccgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctgtccaagcctctcaccctgagatgggagtcccgctctcag
ttccctgccatcatcacgggagtcattactgccctggttctccttgtggttgttatgctg
gctggagctgcgatctggaagaagatgagctcaggtggaaaaggacggaaatatgctcag
gctgcaagcagcaacagtgcccagggctctgatacgtctctgatggcttga

KEGG   Loxodonta africana (African savanna elephant): 100661889
Entry
100661889         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-37 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100661889
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100661889
   04145 Phagosome
    100661889
  09143 Cell growth and death
   04218 Cellular senescence
    100661889
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100661889
   04612 Antigen processing and presentation
    100661889
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100661889
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100661889
   05330 Allograft rejection
    100661889
   05332 Graft-versus-host disease
    100661889
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100661889
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100661889
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100661889
   05170 Human immunodeficiency virus 1 infection
    100661889
   05168 Herpes simplex virus 1 infection
    100661889
   05163 Human cytomegalovirus infection
    100661889
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661889
   05169 Epstein-Barr virus infection
    100661889
   05165 Human papillomavirus infection
    100661889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100661889
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100661889
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100661889
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100661889
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 Insulin_TMD EphA2_TM
Other DBs
NCBI-GeneID: 100661889
NCBI-ProteinID: XP_010600918
LinkDB
Position
Unknown
AA seq 262 aa
GAGLTAGAGSGSHTLQRIHGCEVGPDGLFLRGYVQYAYDGADYITLSQDMRSWTAADTTA
QITQRKWEADKVADQEKAYLEGACVEGLRRYLENGKESLQRADPPKALVTNHPISDHEVM
LRCWALGFYPAEITLTWQRDGEDQTQDMELVETRPAGDGTFQKWVAMVVPPGEEQRYTCR
VQHEGLPKPLTLRWEPPPQSTIPVMGIVAGLVLFGALVVGAVVAAVVILRKRSSGGKRRS
SMQTANGDSAQGSNISLMASKA
NT seq 791 nt   +upstreamnt  +downstreamnt
cgggggcggggctgacggcgggggcggggtcagggtctcacaccttacagaggatacacg
gctgtgaagtgggtcccgacgggctcttcctccgcgggtacgttcagtatgcctacgacg
gcgccgactacatcaccctgagccaggacatgcgctcctggaccgcggcggacacgaccg
ctcagatcacccagcgcaagtgggaggctgacaaggttgcagatcaggaaaaggcctact
tggagggtgcgtgtgtggaggggctccgcagatacctggagaacgggaaggagtctctgc
agcgtgcagatcccccaaaggcacttgtgaccaaccaccccatctctgaccatgaggtca
tgctgagatgctgggccctgggcttctacccggctgagatcacactgacatggcagcggg
acggggaggaccagacccaggacatggagcttgtggagactaggcctgcgggggacggga
ccttccaaaagtgggtggccatggtggtgccccctggagaggagcagagatacacgtgtc
gtgtgcagcatgaggggctgcctaagcccctcaccttgagatgggagccaccccctcagt
ccaccatccccgtcatgggaatagttgctggcctggtgctctttggagcactggttgttg
gagctgtggtggctgcagttgtgatcttgaggaagaggagctcaggtggaaagagaagga
gctccatgcagactgcaaatggcgacagtgcccagggctctaatatatctctcatggctt
ctaaagcttaa

KEGG   Loxodonta africana (African savanna elephant): 100662084
Entry
100662084         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100662084
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100662084
   04145 Phagosome
    100662084
  09143 Cell growth and death
   04218 Cellular senescence
    100662084
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100662084
   04612 Antigen processing and presentation
    100662084
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100662084
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100662084
   05330 Allograft rejection
    100662084
   05332 Graft-versus-host disease
    100662084
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100662084
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100662084
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100662084
   05170 Human immunodeficiency virus 1 infection
    100662084
   05168 Herpes simplex virus 1 infection
    100662084
   05163 Human cytomegalovirus infection
    100662084
   05167 Kaposi sarcoma-associated herpesvirus infection
    100662084
   05169 Epstein-Barr virus infection
    100662084
   05165 Human papillomavirus infection
    100662084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100662084
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100662084
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100662084
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100662084
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_2 LapA_dom PTP_tm
Other DBs
NCBI-GeneID: 100662084
NCBI-ProteinID: XP_023398346
LinkDB
Position
Unknown
AA seq 364 aa
MAPRTLLLLLLGALALTQTRAGSHSLRYFHTAVSRPGRGEPRFISVGYVDDTEFVWFDSD
AANPRMEPRAPWIEQEGPEYWDQETQNAKVTAQNYRVNLRTLRGYYNQSDAGSHTLQRMY
GCEVGPDGRLLRGYLQFAYDGADYLALNEDLSSWTAADRAAQISKGKFEKGGEAEYRRAY
LEGSCVQWLSKYLEKGKETLQRVDPPKTLMTYHRISDHETTLKCWALGFYPAEITLTWQR
DGEDQTQDMELVETRPAGDGTFQKWAALVVPSGEEQKYTCRVQHEGLSEPVTLRWELSSQ
ASTPIIGVVAGLLLLGAVVLGVVVAGAVVMWRKKNSGGKGGSYTQGSSSNSDQGSDVSLI
ASKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgccccggaccctcctcctgctgctcttgggggccctggccctgacccagacccgg
gcgggctcccactccctgaggtattttcacaccgccgtgtcccggcccggccgcggggag
ccccgcttcatctccgtcggctacgtggacgacacggagttcgtgtggttcgacagcgac
gcagcgaacccgaggatggagccgcgggcgccgtggatcgagcaggaggggccggagtat
tgggaccaggagacacagaacgccaaggtcaccgcacagaactaccgagtgaacctgcgg
accctgcgcggctactacaaccagagcgacgccgggtctcacaccctccagaggatgtat
ggctgtgaagtgggtcccgacgggcgcctcctccgcgggtaccttcagtttgcctacgac
ggcgccgactatctggccctgaacgaggacttgagctcctggactgcggcggacagggca
gctcagatctcaaagggcaaattcgagaagggcggggaggcggagtatcggagggcctac
ctggagggctcatgcgtgcagtggctgagcaaatacctggagaaggggaaggagacgctg
cagcgggtagatcccccaaagacactcatgacctaccaccgcatctctgaccatgagacc
acactgaagtgttgggccctgggcttctacccggcggagatcaccctgacctggcagcgg
gatggggaggaccagacccaggacatggagcttgtggagacccggcctgcaggagacggg
acgttccagaagtgggcagccctggtggtgccctctggagaggaacagaaatacacgtgc
cgtgtgcagcatgaggggctgtctgagcctgtcaccctgcgatgggaactgtcttcccag
gccagcacccccatcataggggttgttgctggcctccttctccttggagctgtggtcctt
ggagttgtggtggctggagctgttgtgatgtggaggaagaagaactcaggtgggaaagga
gggagctacactcaaggttcaagcagcaacagtgaccagggctctgatgtctctctcata
gcttctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100664043
Entry
100664043         CDS       T04351                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-5 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100664043
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100664043
   04145 Phagosome
    100664043
  09143 Cell growth and death
   04218 Cellular senescence
    100664043
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100664043
   04612 Antigen processing and presentation
    100664043
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100664043
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100664043
   05330 Allograft rejection
    100664043
   05332 Graft-versus-host disease
    100664043
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100664043
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100664043
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100664043
   05170 Human immunodeficiency virus 1 infection
    100664043
   05168 Herpes simplex virus 1 infection
    100664043
   05163 Human cytomegalovirus infection
    100664043
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664043
   05169 Epstein-Barr virus infection
    100664043
   05165 Human papillomavirus infection
    100664043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664043
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100664043
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100664043
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100664043
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 100664043
NCBI-ProteinID: XP_023397141
LinkDB
Position
Unknown
AA seq 467 aa
MVIVSQILLFLLSGPLALTQARAGEYGVGRETASAKGGGGDHVVGTQDPRGSCPLPDPLS
RPLPSLSPHFVPALLLPLPLLGPPPLTPDPSSPSPRPSTPDPGPRGEGGVGGLSRSPPPG
SHSLRYFDTVVSRPGRGEPRYIAVGYVDDTEFVRFDSDAVNPRAEPRAPWMEQEGPEYWD
RETRSAKGTAQAFRVSLRNVRGYYNQSDAGSHTFQRIYGCEVGPDGLFLRGYAQYAYDGS
DYITLSQDMRSWTAADTTAQITQRKWEADKYADQVKAYLEGACVEGLRRYLENGKESLQR
ADPPKAHVTNHPISDHEVMLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWVAIVVLSGEKQRYTCRVQHEGLPKPLTLRWEPLPQSTIPVMGIVAGLVLFGALAFGA
VVAAVVILRKRSSGCVLPTGGKGRSSTQTANGDSAQGSDMSLMTSKA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtgatagtttcccagatcctcctcttcttgctctcggggcccctggccctgacccag
gcccgagcgggtgagtacggggtcgggagggaaacagcctcggcgaagggaggaggaggg
gaccacgtggtcgggacgcaggaccctcggggaagctgccccctcccagaccccctctcc
cgtcccctcccctccctctcccctcactttgtcccggccctgcttctcccgctgcccctt
cttggtccaccaccgctcacccctgacccctcttccccctccccgcgcccatcgaccccg
gacccgggcccgcgcggggagggaggggtcggtggtctcagccgctccccgcccccaggc
tcccactccctgaggtatttcgacaccgttgtgtcccggcccggccgcggggagccccgg
tacatcgccgtcggctacgtggacgacacggagttcgtgcggttcgacagcgacgccgtg
aacccgagggcggagccgcgggcgccgtggatggagcaggaggggccggagtattgggac
cgggagacacggagcgccaagggcaccgcacaggctttccgagtgagcctgcggaacgtg
cgcggctactacaaccagagcgacgccgggtctcacacattccagaggatatatggctgt
gaagtgggtcctgacgggctcttcctccgcgggtacgctcagtacgcctacgacggctcc
gactacatcaccctgagccaggacatgcgctcctggaccgcggcggacacgaccgctcag
atcacccagcgcaagtgggaggctgacaagtatgcagatcaggtcaaggcctacttggag
ggtgcctgtgtggaggggctccgcagatacctggagaacgggaaggagtctctgcagcgt
gcagatcccccaaaggcacatgtgaccaaccaccccatctctgaccatgaggtcatgctg
agatgctgggccctgggcttctacccagctgagatcacactgacctggcagcgggacggg
gaggaccagacccaggacacagagcttgtggagactaggcctgcgggggatgggaccttc
cagaagtgggtggccatagtggtgctctctggagagaagcagagatacacgtgtcgtgtg
cagcatgaggggctgcctaagcccctcaccttgagatgggagccactccctcagtccacc
atccccgtcatgggaatagttgctggcctggtgctctttggagccctggcttttggagct
gtggtggctgcagttgtgatcttaaggaagaggagctcaggatgtgttcttcccacaggc
ggaaagggaaggagctccacacagactgcaaatggcgacagtgcccagggatctgatatg
tctctcatgacttctaaagcttaa

KEGG   Loxodonta africana (African savanna elephant): 100664893
Entry
100664893         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-3 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100664893
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100664893
   04145 Phagosome
    100664893
  09143 Cell growth and death
   04218 Cellular senescence
    100664893
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100664893
   04612 Antigen processing and presentation
    100664893
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100664893
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100664893
   05330 Allograft rejection
    100664893
   05332 Graft-versus-host disease
    100664893
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100664893
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100664893
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100664893
   05170 Human immunodeficiency virus 1 infection
    100664893
   05168 Herpes simplex virus 1 infection
    100664893
   05163 Human cytomegalovirus infection
    100664893
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664893
   05169 Epstein-Barr virus infection
    100664893
   05165 Human papillomavirus infection
    100664893
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664893
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100664893
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100664893
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100664893
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 MHC_I_C Ig_3 ig SNO
Other DBs
NCBI-GeneID: 100664893
NCBI-ProteinID: XP_023397179
LinkDB
Position
Unknown
AA seq 383 aa
MLMASQILLLLLSGTLPLTQTRAGECVQSRSHPVCALWVPDPGAALGERRWFSRYRLQGS
HSLNFLTPGSSHRGWETPMDLRRHREPSRLCVQLLNHIAFLMKQQTAPLRFSGSQLHTEA
LGPAQPLDPGRAARIRWSFQFRPKRLSWLGRPRGRSGSHTIQALSICEVGSDGRFLRGYR
RIVNEDRRSWTAAAGAAQITRREWEEAGEAERVRAFLEGECVEWLHRYLEKGKETLLRAD
PPKAYVTHHPISDGVVTLKCWASGFYPSEITLTWQRDGEDQTQDTEFVETRPAGDGTFQK
WAALVVPSGEEQRYVCLVQHEGLSEPLTLRWEVPPQPTTSILGIVAGLVLLGAVVTGVVI
WIKKSSGGDSAQGTDVPLTDSKA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgctaatggcttcccagatcctcctcttgttgctctccgggaccctgcccctgacccag
acccgggcgggtgagtgtgtgcagtcccggtctcatcctgtgtgcgctttatgggtcccg
gacccgggagccgcgctgggagagcgtcggtggttcagccgctaccggctgcaggggtcc
cactccctgaactttctcacgccagggtcctcgcaccggggttgggaaaccccgatggat
ctcagacgacaccgtgaaccttcgcgcctgtgtgtccagctgctaaaccacatcgcgttc
ttgatgaagcaacagaccgcacctttacgattctccgggtcccaacttcacactgaggcc
ttgggacccgcccagcccctcgacccgggaagagccgcgaggattcgctggagttttcag
tttaggccgaaacggctaagttggctgggccgaccgcgggggcggtcaggttctcacacc
atccaggcgctgtctatctgcgaggtagggtcggacgggcgcttcctccgcgggtaccgt
cggatcgtgaacgaggaccggcgctcctggacggcggcggccggcgcggctcagatcacc
cggcgggagtgggaggaggccggtgaggcggagcgcgtcagagccttcctggaaggagag
tgtgtggagtggctgcatagatacctggagaaagggaaggagacgctgctgcgagcagat
cccccaaaggcatatgtgacccaccaccccatctctgatggtgtggtcacgctgaagtgc
tgggcctcgggcttctacccttcggagatcaccctgacctggcaacgagatggggaggac
cagacccaggacacagagtttgtggagaccaggcctgcaggggacgggaccttccagaag
tgggctgccctggtagtaccctctggagaggagcagagatatgtgtgccttgtgcagcat
gaggggctgtctgagcccctcaccttgagatgggaggtgcctcctcagcccaccacttcc
atcctgggaattgttgctggcctggttctcctaggagctgtggtcactggagttgtgatc
tggataaagaagagctcaggtggtgacagtgcccagggcactgatgtgcctctcacagat
tctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100666034
Entry
100666034         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, Cw-3 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100666034
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100666034
   04145 Phagosome
    100666034
  09143 Cell growth and death
   04218 Cellular senescence
    100666034
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100666034
   04612 Antigen processing and presentation
    100666034
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100666034
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100666034
   05330 Allograft rejection
    100666034
   05332 Graft-versus-host disease
    100666034
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100666034
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100666034
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666034
   05170 Human immunodeficiency virus 1 infection
    100666034
   05168 Herpes simplex virus 1 infection
    100666034
   05163 Human cytomegalovirus infection
    100666034
   05167 Kaposi sarcoma-associated herpesvirus infection
    100666034
   05169 Epstein-Barr virus infection
    100666034
   05165 Human papillomavirus infection
    100666034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666034
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100666034
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100666034
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100666034
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 100666034
NCBI-ProteinID: XP_023397162
LinkDB
Position
Unknown
AA seq 278 aa
MLPPPRPPLPSPPLPLPSLCPGPAFPAAPSRSTTVHASPLLPFPRPSTPDPGPRGEGGVG
GLSRSPPPGSHSLRYFDTAVSRPGRGEPRFIAVGYVDDTEFMRFDSDAAKPRAEPRAPWM
EQEGPEYWDRETQRVQGHAQALRVGLRNVRGYYNQSDAGSHTFQKIYGCEVGPDGLFLRG
YAQFAYDGADYITLSQDLSSWTAADTTAQITQHNWEAGKFADQVKAYLEGACVEGLHRCL
GNGKESLQRAGTWTCGATPTSPLGLGCSSNRPPIGTDT
NT seq 837 nt   +upstreamnt  +downstreamnt
atgctgccccctcccagaccccctctcccgtcccctcccctccctctcccctcactttgt
cccggccctgcttttcccgctgccccttctcggtccaccaccgttcatgcctcacccctc
ctccccttcccgcgcccatcgaccccggacccgggcccgcgcggggagggaggggtcggt
ggtctcagccgctccccgcccccaggctcccactccctgaggtatttcgacaccgctgtg
tcccggcccggccgcggggagccccgcttcatcgccgtcggctacgtggacgacacggag
ttcatgcggttcgacagcgacgccgcgaagccgagggcggagccgcgggcgccgtggatg
gagcaggaggggccggagtattgggaccgggagacacagagagtccagggccacgcacag
gctttgcgagtgggcctgcggaacgtgcgcggctactacaaccagagcgacgccgggtct
cacaccttccagaagatatatggctgtgaagtaggtcccgacgggctcttcctccgcggg
tacgctcagtttgcctacgacggcgccgactacatcaccctgagccaggacctgagctcc
tggaccgcggcggacacgaccgctcagatcacgcagcacaactgggaggctggcaagttt
gcagatcaggtcaaggcctacttggagggtgcgtgtgtggaggggctccacagatgcctg
gggaacgggaaggagtctctgcagcgtgcaggtacgtggacttgtggggcgactcccacg
tctccccttggcttaggctgttcctccaacaggcctcccataggaacggacacctga

KEGG   Loxodonta africana (African savanna elephant): 100666699
Entry
100666699         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-3 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100666699
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100666699
   04145 Phagosome
    100666699
  09143 Cell growth and death
   04218 Cellular senescence
    100666699
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100666699
   04612 Antigen processing and presentation
    100666699
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100666699
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100666699
   05330 Allograft rejection
    100666699
   05332 Graft-versus-host disease
    100666699
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100666699
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100666699
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666699
   05170 Human immunodeficiency virus 1 infection
    100666699
   05168 Herpes simplex virus 1 infection
    100666699
   05163 Human cytomegalovirus infection
    100666699
   05167 Kaposi sarcoma-associated herpesvirus infection
    100666699
   05169 Epstein-Barr virus infection
    100666699
   05165 Human papillomavirus infection
    100666699
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100666699
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100666699
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100666699
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100666699
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_C ig MHC_I_3 Ig_2 PepSY_TM
Other DBs
NCBI-GeneID: 100666699
NCBI-ProteinID: XP_023397436
LinkDB
Position
Unknown
AA seq 347 aa
MASQVLLFLLSGSLALTQTQAGSHSLSHFFTAVSRPGGGEPRVIAVGYVDDTQLGRFDSD
AANPRAEPRTWWMEQEEQEHLEELTRRAKGVAQNLRVHLWTLRGYYNQSASGSHTIQWLS
ACDLRSDGRFLRGYRQMAYDGTDYIALNEDLRSWTAADAAAQITQREWEEAGRAERVRAF
LEGDCVEWLYRYLEKGKETLLRADPPKAYVTHHPISDHEVTLRCWALGFYPVEITLTWQR
DGEDQTQDTELVETRPAGDGTFQKWAALVVPSGEEQRYVCRVQHEGLSEPLTLRWEVPPQ
PTTSILGIVAGLVLLGAVVTGVVIWIKKSSGGNSAQGSDVSFTDSKA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcttcccaggtccttctcttcttgctttccgggtccctggccctgacccagacccag
gcgggctcccactccctgagccatttcttcaccgccgtgtcccggcccggcggcggggag
ccccgcgtcatcgccgtcggctacgtggacgacacgcaattgggacgctttgacagcgac
gccgcaaatcccagagcggagccgcggacgtggtggatggagcaggaggagcaggagcac
ttggaagagctgacccgcagagccaagggcgtcgcacagaatttgcgagtgcacctgtgg
accctgcgcggctactacaaccagagcgcctccggttctcacaccatccagtggctgtct
gcctgtgacctaaggtcggacgggcgcttcctccgggggtaccgtcagatggcctacgat
ggcaccgattacattgccctgaacgaggacctgcgctcctggacggcggcggacgccgcg
gctcagatcacccagcgggagtgggaggaggccggtagggcggagcgagtcagagccttc
ctggagggggactgtgtggagtggctgtacagatacctggagaaagggaaggagacgctg
ctgcgagcagatcccccaaaggcatatgtgacccaccaccccatctctgatcacgaggtc
acgctgaggtgctgggccctgggcttctaccctgtggagatcacactgacctggcagcga
gatggagaggaccagacccaggacacagagcttgtggagaccaggcctgcgggggacggg
accttccagaagtgggctgccctggtagtaccctctggagaggagcagagatacgtgtgc
cgtgtgcagcacgaggggctgtctgagcccctcaccctgagatgggaagtgcctcctcag
cccaccacttccatcctgggaattgttgctggcctggttctcctaggagctgtggtcact
ggcgttgtaatctggataaagaagagctcaggtggtaacagtgcccagggctctgatgtg
tctttcacagattctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100667271
Entry
100667271         CDS       T04351                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100667271
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100667271
   04145 Phagosome
    100667271
  09143 Cell growth and death
   04218 Cellular senescence
    100667271
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100667271
   04612 Antigen processing and presentation
    100667271
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100667271
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100667271
   05330 Allograft rejection
    100667271
   05332 Graft-versus-host disease
    100667271
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100667271
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100667271
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667271
   05170 Human immunodeficiency virus 1 infection
    100667271
   05168 Herpes simplex virus 1 infection
    100667271
   05163 Human cytomegalovirus infection
    100667271
   05167 Kaposi sarcoma-associated herpesvirus infection
    100667271
   05169 Epstein-Barr virus infection
    100667271
   05165 Human papillomavirus infection
    100667271
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667271
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100667271
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100667271
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100667271
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C C2-set_2 MHC_I_3 ig Imm74 Peptidase_M6
Other DBs
NCBI-GeneID: 100667271
NCBI-ProteinID: XP_010600063
LinkDB
Position
Unknown
AA seq 349 aa
MVMASQILLFLLSGSLALTQTQAGSHSLSHFFTAVSRPGGGEPRVIAVAYVDDTQLGRFD
SDAANPRAEPRTWWMEQEEQEHLEELTRRAKGVAQDLRVDLWTLRGYYNQSASGSHTIQA
LSACEVRSDGRFLRGYRQMAYDGTDYIALNEDLRSWTAADAAAQITRREWEEAGVTKLAR
AFLEEDCLEWLHRYLEKGKETLLRADPPKAYVTHHPISDREVTLRCWALGFYPAEITLTW
QRDGEDQTQDTELVETRPAGDGTFQKWAALVVPSGKEQRYVCHVQHEGLPEPLTLRWKVP
PHPTTSILGIVAGLVLLGAVVTGVVIWIKKSSGGNSAQGSDVPLTDSKA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggtgatggcgtcccagatcctcctcttcttgctctcggggtccctggccctgacccag
acccaggcgggctcccactccctgagccatttcttcaccgccgtgtcccggcccggcgga
ggggagccccgcgtcatcgccgtcgcctacgtggacgacacgcaattgggacgctttgac
agcgacgccgcgaatcccagagcggagccgcggacgtggtggatggagcaggaggagcag
gagcacttggaagagctgacgcgcagagccaagggcgtcgcacaggatttgcgagtggac
ctgtggaccctgcgcggctactacaaccagagcgcctccggttctcataccatccaggcg
ctgtctgcctgcgaggtgaggtcggacgggcgcttcctccgcgggtaccgtcagatggcc
tacgatggcaccgattacattgccctgaacgaggacctgcgctcctggacggcggcggac
gccgcggctcagatcacccggcgggagtgggaggaggccggtgtgacgaagctcgccaga
gccttcctggaggaggactgtttggagtggctgcatagatacctggagaaagggaaggag
acgctgctgcgagcagatcccccaaaggcttatgtgacccaccaccccatctctgaccgt
gaggtcacactgaggtgctgggccctgggcttctaccctgcggagatcacactgacctgg
cagcgagatggagaggaccagacccaggacacagagcttgtggagaccaggcctgcgggg
gacgggaccttccagaagtgggccgccctggtagtaccctctggaaaggagcagagatat
gtgtgccatgtgcagcacgaggggctgcctgagcccctcaccctgagatggaaagtgcct
cctcatcccaccacttccatcctgggaattgttgctggcctggttctcctaggagctgtg
gtcactggcgttgtgatctggataaagaagagctcaggtggtaacagtgcccagggctct
gatgtgcctctcacagattctaaagcgtga

KEGG   Loxodonta africana (African savanna elephant): 100667840
Entry
100667840         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-40 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100667840
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100667840
   04145 Phagosome
    100667840
  09143 Cell growth and death
   04218 Cellular senescence
    100667840
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100667840
   04612 Antigen processing and presentation
    100667840
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100667840
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100667840
   05330 Allograft rejection
    100667840
   05332 Graft-versus-host disease
    100667840
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100667840
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100667840
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667840
   05170 Human immunodeficiency virus 1 infection
    100667840
   05168 Herpes simplex virus 1 infection
    100667840
   05163 Human cytomegalovirus infection
    100667840
   05167 Kaposi sarcoma-associated herpesvirus infection
    100667840
   05169 Epstein-Barr virus infection
    100667840
   05165 Human papillomavirus infection
    100667840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100667840
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100667840
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100667840
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100667840
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100667840
NCBI-ProteinID: XP_023397413
LinkDB
Position
Unknown
AA seq 327 aa
MIILSTPRTLLVLLSGALFLTQTKAGSHSLRYFHTAVSRPGRGEPRFIEVGYVDDTQFVR
FDSDAANPRMEPRARWVEREGPEHWDQETRIAKDNAQNYRVNLRTLRGYYNQSDAGSHTI
QVMFGCEVGSDGRLLRWYNQHAYDGADYIALNEDLQSWTAADTAAQITQRKWEEAGVADH
IRAYVEGRCLEWLRRYLENGKETLRRAVPPRMHMTHHHISDHEATLKCWALGFYPAEITL
TWQRDGEDQTQDIELVETRPSGDGTFQKWVVVVVPSGEEHRYTCNVQHEGLLEPFTLRWE
TSSQPTSLVMSIVAGLVPVAVVVENVI
NT seq 984 nt   +upstreamnt  +downstreamnt
atgatcatcctcagtacaccccggaccctcctcgtgttgctctcgggggcactgttcctc
acccagaccaaggcgggctcccactccctgaggtattttcacaccgccgtgtcccggccc
ggccgcggggagccccgcttcatcgaagtcggctatgtggacgacacgcagttcgtgcga
ttcgacagcgacgccgcgaatccgaggatggagccgcgggcgcggtgggtggagcgggag
gggccggagcattgggaccaggagacacggatcgccaaggacaacgcacagaactaccga
gtgaacctgcggaccctgcgcggctactacaaccagagcgacgccgggtctcacaccatt
caggtgatgttcggctgcgaagtggggtcagatggtcgccttctccgctggtacaatcag
catgcctatgatggcgccgattacatcgccctgaatgaggacctgcaatcctggacagcg
gcggacacggccgctcagattacgcagcgcaagtgggaggaggccggtgtggcggaccac
atcagggcctacgtggagggcaggtgcctggagtggctccgcagatacctggaaaacggg
aaggagacgctgcggcgagcagtgcccccaaggatgcacatgacccaccaccacatttct
gaccatgaggccacactgaagtgctgggccctgggcttctacccagcggagatcaccctg
acctggcagcgggatggggaggaccagacccaggacatagagcttgtggagaccaggcct
tcgggggatgggaccttccagaagtgggtggtggtggtggtgccctctggagaggagcac
agatacacgtgcaatgtgcagcatgaggggctgctggagcccttcaccctgagatgggaa
acatcttcccagcccactagcctcgtcatgagcattgttgctggcctggttcctgtagct
gtggttgttgaaaatgtgatctga

KEGG   Loxodonta africana (African savanna elephant): 100669340
Entry
100669340         CDS       T04351                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100669340
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669340
   04145 Phagosome
    100669340
  09143 Cell growth and death
   04218 Cellular senescence
    100669340
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100669340
   04612 Antigen processing and presentation
    100669340
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100669340
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100669340
   05330 Allograft rejection
    100669340
   05332 Graft-versus-host disease
    100669340
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100669340
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100669340
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100669340
   05170 Human immunodeficiency virus 1 infection
    100669340
   05168 Herpes simplex virus 1 infection
    100669340
   05163 Human cytomegalovirus infection
    100669340
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669340
   05169 Epstein-Barr virus infection
    100669340
   05165 Human papillomavirus infection
    100669340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100669340
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100669340
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100669340
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100669340
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig Titin_Ig-rpts
Other DBs
NCBI-GeneID: 100669340
NCBI-ProteinID: XP_010591301
LinkDB
Position
Unknown
AA seq 355 aa
MAELASLELENKSWPRGTHSLRYHYLALSEPGPGLPQFLAVGYVDDQPFIRYDSRVGRAQ
SQAPWMVLVDTQYWERETQKQRGWEKVQQVEMWTVMGYHNLSSGKHSAQRMFGCEIQEDG
RSNSFWQFGFNGQDHLSLDLDTLSWVSAHPVALRTKRWWETERCYAQYDKAYLQGLCLTS
LRRYLELGGQSLTRTEPPKVQVTWHIGQDGRVTLKCWALGFYPQDISLSWWLRGEELALE
TEHVETRPSGDGTYQKWAAVQVPAGEESGYTCHVQHPGLNHTLTMTYESPSHPRLIADLV
IFSILVTISPVAAVVIWIKKKPSARDKESYQQAPGEEDLHKSQSTSRVVTIQHLC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcagagctggccagtctggagttagaaaacaaatcatggcctagagggacccactct
ctccgctaccactacctggccctgtcagagccaggcccgggcctcccccaatttctggct
gtgggctatgtggacgaccagcccttcatccggtatgacagtcgcgtgggcagggcccag
tcccaggccccgtggatggtgctcgtggacacccagtactgggagagggagacccagaag
cagaggggctgggagaaggtgcagcaggtggagatgtggaccgtgatgggctaccacaac
ctcagcagcggcaagcacagcgctcagcgtatgtttggctgcgagattcaggaggatggc
cgctccaacagtttctggcagtttggcttcaatgggcaggaccacctgtcattggacctg
gatacactgagctgggtgtcagcccatcctgtggccttacgaacaaagcgctggtgggag
acagagcgctgctacgcccagtacgacaaggcgtatctgcaaggcctctgcctcacctcg
ctgcgcaggtacctggagctaggaggccagagtctgactcgcacagagccacccaaggta
caggtgacatggcacataggccaggatggcagggtcacactgaagtgctgggccttgggc
ttctacccacaggacatctccctgagctggtggctgaggggagaggagctggccctagag
actgagcacgtggagacgcgtcccagcggggatggcacctaccagaagtgggcagccgtg
caggtgcctgctggggaggagtccgggtacacctgccacgtgcagcacccgggcctgaac
catacactcaccatgacctatgaatcaccgtctcatccaagacttattgccgacttggtt
atcttcagcatcctggtcaccatatccccagtggctgcagttgtgatctggatcaagaag
aaaccttcagccagggataaggaatcttaccagcaagccccaggtgaagaggacctccat
aaatcccaaagcacctcaagagtagtgactattcagcatctctgctga

KEGG   Loxodonta africana (African savanna elephant): 100676481
Entry
100676481         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain G-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100676481
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100676481
   04145 Phagosome
    100676481
  09143 Cell growth and death
   04218 Cellular senescence
    100676481
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100676481
   04612 Antigen processing and presentation
    100676481
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100676481
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100676481
   05330 Allograft rejection
    100676481
   05332 Graft-versus-host disease
    100676481
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100676481
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100676481
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676481
   05170 Human immunodeficiency virus 1 infection
    100676481
   05168 Herpes simplex virus 1 infection
    100676481
   05163 Human cytomegalovirus infection
    100676481
   05167 Kaposi sarcoma-associated herpesvirus infection
    100676481
   05169 Epstein-Barr virus infection
    100676481
   05165 Human papillomavirus infection
    100676481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676481
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100676481
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100676481
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100676481
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig Peptidase_M6
Other DBs
NCBI-GeneID: 100676481
NCBI-ProteinID: XP_023398138
LinkDB
Position
Unknown
AA seq 375 aa
MMMVSQILLFLLLGSLSLTQIQAGSHSLSHFFTAVSRAGGVEPRVIAVGYVDDTQFGHFD
SDAANPRAEPRTPWAEQDEQEHWEELTRRAKGVAQDLRVDLWTLRGYYNQSDSGSHTIQW
LSACEVRSDGRFLRGYRRIAYDGTDYIALNEDLRSWTAADAAAQITRRQWEEAGVAELVR
AYLEEECVEWLHRYLEKGKETLLRADPPKAYVTRHPISDHEVTLRCWALGFYPAEIILTW
QRDGEDQTQDTELVETRPAGDGNFQKWASLAVPSGEEQRYVCHVQHEGLSEPLTLKWGKQ
RTRAKLHLRVLFWAPPAGSGVRPRGQGPFSSIAFSSHPRGASSAHHFHPGNCCWPGSPRS
CGHWSCDLVKEELRW
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgatgatggtttcccagatcctcctcttcttgctcttagggtccctgtccctgacccag
atccaggcgggctcccactccctgagccatttcttcaccgccgtgtcccgggccggcggc
gtggagccccgcgtcatcgccgtcggctacgtggacgacacgcagttcggacactttgac
agcgacgccgcgaatcccagagcggagccgcggacgccgtgggcggagcaggacgagcag
gagcactgggaagagctaacccgtagagccaagggcgtcgcacaggatttgcgagtggac
ctgtggaccctgcgcggctattacaaccagagcgactccggttctcacaccatccagtgg
ctgtctgcctgcgaggtgaggtcggacgggcgcttcctccgcgggtaccgtcggatcgcc
tacgacggaaccgattacattgccctgaacgaggacctgcgctcctggacggcggcggac
gccgcggctcagatcacccggcgccagtgggaggaggccggtgtggcggagcttgtcaga
gcctacctggaggaggagtgtgtggagtggctgcatagatacctggagaaagggaaggag
acgctgctgcgagcagatcccccaaaggcttatgtgacccgccaccccatctctgaccat
gaggtcacgctgaggtgctgggccctgggcttctatcctgcggagatcatactgacctgg
cagcgagatggagaggaccagacccaggacacagagcttgtggaaaccaggcctgcgggg
gatgggaacttccagaagtgggcctccctggcggtaccctctggagaggagcagagatac
gtgtgccacgtgcagcacgaggggctatctgagcccctcaccctgaaatggggtaagcag
aggacaagggcaaagcttcacctcagggtgctcttctgggcacctccagcagggtcaggg
gtgagacctagaggtcagggccccttctcttccattgccttttcttcccatcctagaggt
gcctcctcagcccaccacttccatcctgggaattgttgttggcctggttctcctaggagc
tgtggtcactggagttgtgatctggttaaagaagagctcaggtggtaa

KEGG   Loxodonta africana (African savanna elephant): 100676584
Entry
100676584         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100676584
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100676584
   04145 Phagosome
    100676584
  09143 Cell growth and death
   04218 Cellular senescence
    100676584
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100676584
   04612 Antigen processing and presentation
    100676584
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100676584
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100676584
   05330 Allograft rejection
    100676584
   05332 Graft-versus-host disease
    100676584
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100676584
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100676584
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676584
   05170 Human immunodeficiency virus 1 infection
    100676584
   05168 Herpes simplex virus 1 infection
    100676584
   05163 Human cytomegalovirus infection
    100676584
   05167 Kaposi sarcoma-associated herpesvirus infection
    100676584
   05169 Epstein-Barr virus infection
    100676584
   05165 Human papillomavirus infection
    100676584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676584
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100676584
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100676584
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100676584
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 MAP17 MHC_I_3 ig EphA2_TM DUF2567 PRIMA1 DUF3112
Other DBs
NCBI-GeneID: 100676584
NCBI-ProteinID: XP_023398360
LinkDB
Position
Unknown
AA seq 364 aa
MAPRALLLLLSGALALTQTRAGSHSLRYFDTTVSRPGGGEPRFIEVGYVDDTQFVRFDSD
AANPRMEPRAPWIEQEGPEYWDRNTQIAKDNAQTSRVSLRTALGYYNQSDAGEXGSHTIQ
VMYGCEVGPDGRLLRGYGQHAYDGADYIALNEDLSSWTAADTAAQITQRKWEAEKYADQF
RAYVEGRCQESLRRYLENGKESLQRADPPKAHITHHPISDREATLRCWALGFYPAEITLT
WQRDGEDQTQDMELVETRPAGDGTFQKWAAMVVPSGEEQRYTCHVQHEGLPKPLTLTWES
RSQSFAIIMGIIAGLVFLVVVVAVVAAAVIWRKKSSDGKGGNYAQAASSNSSQGSDVSLM
ACKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcgccccgggccctcctcctgctgctctcgggggccctggccctgacccagacccgg
gcgggctcccactccctgaggtatttcgacaccaccgtgtcccggcccggcggcggggag
ccccgcttcatcgaagtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gccgcgaacccgaggatggagccgcgggcgccgtggatcgagcaggaggggccggagtat
tgggatcggaacacacagatcgccaaggacaacgcacagacttcccgagtgagcctgcgg
accgcgctgggctactacaaccagagcgacgccggtgagtgagggtctcacaccatccag
gtgatgtacggctgtgaagtggggcccgacgggcgcctcctccgtggctatgggcagcac
gcctacgacggcgccgactacatcgccctgaacgaggacctgagctcctggacggcggcg
gacacggcagctcagatcacccagcgcaagtgggaggctgagaagtatgcagatcagttc
agggcctacgtggagggcaggtgccaggagtcgctccgcagatacctggagaacgggaag
gagtctctgcagcgcgcagacccccccaaagcacacataacccaccaccccatctctgac
cgtgaggccacgctgaggtgctgggccctgggcttctaccctgcggagatcaccctgacc
tggcagcgggacggagaggaccagacccaggacatggagcttgtggagaccaggcctgca
ggggacggaaccttccagaagtgggcagccatggtggtgccctctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgcccaagcctctcaccctgacatgggagtcc
cgttctcagtccttcgccatcatcatgggaatcattgctggcctggtattccttgtggtc
gttgtagctgtggtggctgcagcggtgatctggaggaagaagagctcagatggaaaagga
gggaactatgctcaggccgcaagcagcaacagttcccagggctctgatgtgtctctcatg
gcttgtaaagcatga

KEGG   Loxodonta africana (African savanna elephant): 100676766
Entry
100676766         CDS       T04351                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-3 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04145  Phagosome
lav04218  Cellular senescence
lav04514  Cell adhesion molecules
lav04612  Antigen processing and presentation
lav04940  Type I diabetes mellitus
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100676766
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100676766
   04145 Phagosome
    100676766
  09143 Cell growth and death
   04218 Cellular senescence
    100676766
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100676766
   04612 Antigen processing and presentation
    100676766
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100676766
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100676766
   05330 Allograft rejection
    100676766
   05332 Graft-versus-host disease
    100676766
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100676766
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100676766
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676766
   05170 Human immunodeficiency virus 1 infection
    100676766
   05168 Herpes simplex virus 1 infection
    100676766
   05163 Human cytomegalovirus infection
    100676766
   05167 Kaposi sarcoma-associated herpesvirus infection
    100676766
   05169 Epstein-Barr virus infection
    100676766
   05165 Human papillomavirus infection
    100676766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676766
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100676766
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100676766
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Antigens
  100676766
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig MHC_I_C Peptidase_M6 Ig_2 Imm74 PepSY_TM
Other DBs
NCBI-GeneID: 100676766
NCBI-ProteinID: XP_023398141
LinkDB
Position
Unknown
AA seq 347 aa
MASQVLLFLLSGSLALTQTQAGSHSLSHFFTAVSRPGGGEPRIIAVGYVDDTQWGRFDSD
AANPRAEPRTWWMEEVEQEHLEELTRRAKGFARDLRVHLWTLRGYYNQSDSSSHTIQALS
ACDVRSDGRFLRGYRQMAYDGTDYIALNEDLRSWTAADAAAQITRREWEEAGEAELARAF
LEGECVEWLHRYLEKGKETLLRADPPKAYVTHHPISDREVTLRCWALGFYPVEITLTWQR
DGEDQTQDTELVETRPAGDGTFQKWAALVVPSGEEQRYVCRVQHEGLSEPLTLRWEVPPH
PTTSILGIVAGLVLLGAVVTGVVIWIKKSSGGNSAQGSEVSFTDSKA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcttcccaggtccttctcttcttgctttcggggtccctggccctgacccagacccag
gcgggctcccactccctgagccatttcttcaccgccgtgtcccggcccggcggcggggag
ccccgcatcatcgccgttggctacgtggacgacacgcagtggggacgctttgacagcgac
gccgcgaatcccagagcggagccgcggacgtggtggatggaggaggtggagcaggagcac
ttggaagagctgacccgcagagccaagggctttgcacgggatttgcgagtgcacctgtgg
accctgcgcggctactacaaccagagcgactccagttctcacaccatccaggcgctgtct
gcctgcgacgtaaggtcggacgggcgcttcctccgggggtaccgtcagatggcctacgat
ggcaccgattacattgccctgaacgaggacctgcgctcctggacggcggcggacgccgcg
gctcagatcacccggcgggagtgggaggaggccggtgaggcggagctcgccagagccttc
ctggagggggagtgtgtggagtggctgcatagatacctggagaaagggaaggagaccctg
ctgcgagcagatcccccaaaggcatatgtgacccaccaccccatctctgatcgcgaggtc
acgctgaggtgctgggccctgggcttctaccctgtggagatcacactgacctggcagcga
gatggagaggaccagacccaggacacagagcttgtggagaccaggcctgcgggggacggg
accttccagaagtgggccgccctggtagtaccctctggagaggagcagagatacgtgtgc
cgtgtgcagcacgaggggctgtctgagcccctcaccctgagatgggaagtgcctcctcat
cccaccacttccatcctgggaattgttgctggcctggttctcctaggagctgtggtcact
ggcgttgtaatctggataaagaagagctcaggtggtaacagtgcccagggctctgaagtg
tctttcacagattctaaagcgtga

DBGET integrated database retrieval system