KEGG   Loxodonta africana (African savanna elephant): 100653731
Entry
100653731         CDS       T04351                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100653731 (PIK3R1)
   04014 Ras signaling pathway
    100653731 (PIK3R1)
   04015 Rap1 signaling pathway
    100653731 (PIK3R1)
   04370 VEGF signaling pathway
    100653731 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100653731 (PIK3R1)
   04668 TNF signaling pathway
    100653731 (PIK3R1)
   04066 HIF-1 signaling pathway
    100653731 (PIK3R1)
   04068 FoxO signaling pathway
    100653731 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100653731 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100653731 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100653731 (PIK3R1)
   04024 cAMP signaling pathway
    100653731 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100653731 (PIK3R1)
   04152 AMPK signaling pathway
    100653731 (PIK3R1)
   04150 mTOR signaling pathway
    100653731 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100653731 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100653731 (PIK3R1)
   04218 Cellular senescence
    100653731 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100653731 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100653731 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100653731 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100653731 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    100653731 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100653731 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100653731 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100653731 (PIK3R1)
   04660 T cell receptor signaling pathway
    100653731 (PIK3R1)
   04662 B cell receptor signaling pathway
    100653731 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100653731 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100653731 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100653731 (PIK3R1)
   04062 Chemokine signaling pathway
    100653731 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100653731 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100653731 (PIK3R1)
   04929 GnRH secretion
    100653731 (PIK3R1)
   04915 Estrogen signaling pathway
    100653731 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100653731 (PIK3R1)
   04917 Prolactin signaling pathway
    100653731 (PIK3R1)
   04926 Relaxin signaling pathway
    100653731 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100653731 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100653731 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100653731 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100653731 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100653731 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100653731 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100653731 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100653731 (PIK3R1)
   04380 Osteoclast differentiation
    100653731 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100653731 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100653731 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653731 (PIK3R1)
   05206 MicroRNAs in cancer
    100653731 (PIK3R1)
   05205 Proteoglycans in cancer
    100653731 (PIK3R1)
   05203 Viral carcinogenesis
    100653731 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100653731 (PIK3R1)
   05231 Choline metabolism in cancer
    100653731 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100653731 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100653731 (PIK3R1)
   05212 Pancreatic cancer
    100653731 (PIK3R1)
   05225 Hepatocellular carcinoma
    100653731 (PIK3R1)
   05226 Gastric cancer
    100653731 (PIK3R1)
   05214 Glioma
    100653731 (PIK3R1)
   05221 Acute myeloid leukemia
    100653731 (PIK3R1)
   05220 Chronic myeloid leukemia
    100653731 (PIK3R1)
   05218 Melanoma
    100653731 (PIK3R1)
   05211 Renal cell carcinoma
    100653731 (PIK3R1)
   05215 Prostate cancer
    100653731 (PIK3R1)
   05213 Endometrial cancer
    100653731 (PIK3R1)
   05224 Breast cancer
    100653731 (PIK3R1)
   05222 Small cell lung cancer
    100653731 (PIK3R1)
   05223 Non-small cell lung cancer
    100653731 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100653731 (PIK3R1)
   05017 Spinocerebellar ataxia
    100653731 (PIK3R1)
   05020 Prion disease
    100653731 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100653731 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100653731 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100653731 (PIK3R1)
   04931 Insulin resistance
    100653731 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100653731 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100653731 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100653731 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100653731 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100653731 (PIK3R1)
   05161 Hepatitis B
    100653731 (PIK3R1)
   05160 Hepatitis C
    100653731 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100653731 (PIK3R1)
   05164 Influenza A
    100653731 (PIK3R1)
   05162 Measles
    100653731 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100653731 (PIK3R1)
   05163 Human cytomegalovirus infection
    100653731 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100653731 (PIK3R1)
   05169 Epstein-Barr virus infection
    100653731 (PIK3R1)
   05165 Human papillomavirus infection
    100653731 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100653731 (PIK3R1)
   05142 Chagas disease
    100653731 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100653731 (PIK3R1)
   01524 Platinum drug resistance
    100653731 (PIK3R1)
   01522 Endocrine resistance
    100653731 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100653731 (PIK3R1)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100653731 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 DUF4201 SH3_2 Laminin_I Lant_dehydr_C PI_PP_I Mod_r
Other DBs
NCBI-GeneID: 100653731
NCBI-ProteinID: XP_003408119
UniProt: G3TKF7
LinkDB
Position
Unknown
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADSEQQALTLLDLAE
QFAPPDIAPPLLVKLVEAIEKKGLECSTLYRTQSSSSPAELRQLLDCDVTSVDWEMIDVH
VLADAFKRYLLDLPNPVIPGAVYSEMMSLAQEVQSSEEHIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQTASKNLLNARALSEIFSPMLFRFPANSSDNTEHLIKVVEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLLWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaggaacgagaagaa
gacattgacctgcatttgggtgacatattgactgtgaataaagggtctttggtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttgaatggctataat
gaaaccacgggggaaaggggagactttccgggaacatatgtagaatatattggaaggaaa
aaaatctcacctcccacaccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcagacagtgagcaacaagctttgactcttctggatcttgcagag
cagtttgcccctcctgacattgctccccctcttcttgtcaagctagtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctctagcagcccagcagaa
ttacgacagcttcttgattgtgatgtcacctccgtggactgggaaatgatcgatgtgcac
gttttagcagatgctttcaaacgctatcttctggacttgccaaatcctgtcattccagga
gccgtttacagtgaaatgatgtctttagcccaagaagtacagagctccgaagaacatatc
cagctgttgaagaagctcattaggtcaccgaacatacctcatcagtattggcttacactt
cagtatttgctaaaacatttcttcaagctctctcaaacggccagcaaaaatctcttgaat
gcaagagcactctctgaaattttcagccctatgcttttcagattcccagcaaacagctct
gataatactgaacacctcataaaagttgtagaaattttaatctcaacggaatggaatgaa
cggcagcctgcaccagcactgccccctaaaccacccaagcccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacgtttttggtacgagatgcc
tctactaaaatgcatggtgattatacgcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaactttcaactct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaagctg
gatgtgaaattgctttatccagtatccaaataccaacaggatcaagtggtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaattccaagaaaaaagt
cgggagtatgatagattatatgaagattatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgaaaagttaaagtcgcgcatcagtgagattgtcgac
agtcgaagaagattggaggaagacttgaagaagcaggcagctgagtatcgagagattgac
aaacgtatgaatagcatcaaaccagacctcatccagctgagaaagacaagagaccaatac
ttgctgtggttgactcaaaaaggtgttcggcagaagaagttgaacgagtggctgggcaat
gaaaacactgaagatcaatattcactggtggaagatgacgaggatttaccccaccacgat
gagaagacctggaatgtgggaagcagcaaccggaacaaagctgagaacctattgcgaggg
aagcgggatggcactttccttgtccgagagagcagtaaacagggctgttacgcctgctct
gtagtggtggatggcgaggtaaagcattgtgtcataaacaagacggcaactgggtatggc
tttgcagagccctataacttgtacagctccctgaaagaactggtgctacattaccaacac
acgtccctcgtgcagcacaacgactccctcaacgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Loxodonta africana (African savanna elephant): 100657948
Entry
100657948         CDS       T04351                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100657948 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100657948 (PIK3CA)
   04014 Ras signaling pathway
    100657948 (PIK3CA)
   04015 Rap1 signaling pathway
    100657948 (PIK3CA)
   04370 VEGF signaling pathway
    100657948 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100657948 (PIK3CA)
   04668 TNF signaling pathway
    100657948 (PIK3CA)
   04066 HIF-1 signaling pathway
    100657948 (PIK3CA)
   04068 FoxO signaling pathway
    100657948 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100657948 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100657948 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100657948 (PIK3CA)
   04024 cAMP signaling pathway
    100657948 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100657948 (PIK3CA)
   04152 AMPK signaling pathway
    100657948 (PIK3CA)
   04150 mTOR signaling pathway
    100657948 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100657948 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100657948 (PIK3CA)
   04218 Cellular senescence
    100657948 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100657948 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100657948 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100657948 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100657948 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100657948 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100657948 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100657948 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100657948 (PIK3CA)
   04660 T cell receptor signaling pathway
    100657948 (PIK3CA)
   04662 B cell receptor signaling pathway
    100657948 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100657948 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100657948 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100657948 (PIK3CA)
   04062 Chemokine signaling pathway
    100657948 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657948 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100657948 (PIK3CA)
   04929 GnRH secretion
    100657948 (PIK3CA)
   04915 Estrogen signaling pathway
    100657948 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100657948 (PIK3CA)
   04917 Prolactin signaling pathway
    100657948 (PIK3CA)
   04926 Relaxin signaling pathway
    100657948 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100657948 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100657948 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100657948 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100657948 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100657948 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100657948 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100657948 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100657948 (PIK3CA)
   04380 Osteoclast differentiation
    100657948 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100657948 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100657948 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657948 (PIK3CA)
   05206 MicroRNAs in cancer
    100657948 (PIK3CA)
   05205 Proteoglycans in cancer
    100657948 (PIK3CA)
   05203 Viral carcinogenesis
    100657948 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100657948 (PIK3CA)
   05231 Choline metabolism in cancer
    100657948 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100657948 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100657948 (PIK3CA)
   05212 Pancreatic cancer
    100657948 (PIK3CA)
   05225 Hepatocellular carcinoma
    100657948 (PIK3CA)
   05226 Gastric cancer
    100657948 (PIK3CA)
   05214 Glioma
    100657948 (PIK3CA)
   05221 Acute myeloid leukemia
    100657948 (PIK3CA)
   05220 Chronic myeloid leukemia
    100657948 (PIK3CA)
   05218 Melanoma
    100657948 (PIK3CA)
   05211 Renal cell carcinoma
    100657948 (PIK3CA)
   05215 Prostate cancer
    100657948 (PIK3CA)
   05213 Endometrial cancer
    100657948 (PIK3CA)
   05224 Breast cancer
    100657948 (PIK3CA)
   05222 Small cell lung cancer
    100657948 (PIK3CA)
   05223 Non-small cell lung cancer
    100657948 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657948 (PIK3CA)
   05017 Spinocerebellar ataxia
    100657948 (PIK3CA)
   05020 Prion disease
    100657948 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100657948 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100657948 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100657948 (PIK3CA)
   04931 Insulin resistance
    100657948 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100657948 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657948 (PIK3CA)
   05135 Yersinia infection
    100657948 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100657948 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657948 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100657948 (PIK3CA)
   05161 Hepatitis B
    100657948 (PIK3CA)
   05160 Hepatitis C
    100657948 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100657948 (PIK3CA)
   05164 Influenza A
    100657948 (PIK3CA)
   05162 Measles
    100657948 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100657948 (PIK3CA)
   05163 Human cytomegalovirus infection
    100657948 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657948 (PIK3CA)
   05169 Epstein-Barr virus infection
    100657948 (PIK3CA)
   05165 Human papillomavirus infection
    100657948 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100657948 (PIK3CA)
   05142 Chagas disease
    100657948 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100657948 (PIK3CA)
   01524 Platinum drug resistance
    100657948 (PIK3CA)
   01522 Endocrine resistance
    100657948 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100657948 (PIK3CA)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100657948 (PIK3CA)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100657948 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100657948
NCBI-ProteinID: XP_003416277
UniProt: G3SRN1
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKISHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWSEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFNYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggagaactgtggggcatccacttgatgcccccaagaatc
ttagtagaatgtttactaccaaatggcatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaagaaaataccctctgtatcaa
cttcttcaggatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaatcgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgacatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatctgagggatctgaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcgccagaactgccaaagcac
atatataacaaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgataagcagaaatatactctgaaaatcagccatgactgtgtgccagaacaggtg
attgccgaagcaatcaggaagaaaactcgaagtatgttgctgtcctccgagcaactaaaa
ctatgtgttttagaatatcagggcaagtatattttaaaagtgtgcggatgtgacgaatat
ttcctcgaaaagtatcctctgagtcaatataagtatataagaagctgtataatgctggga
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcagctgccaatggac
tgttttacaatgccatcttactccaggcgcatttccacagctacaccctatatgaatgga
gaaacatctacaaaatccctttgggttatcaatagtgcactcagaataaaaattctctgt
gcaacctatgtgaatgtaaatattcgagatattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtaaacactcaaagagtaccttgttccaat
cccaggtggagtgaatggctgaattatgacatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacattgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattggaagatttactgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcctggagttggagtttgactggttt
agcagtgttgtgaagtttccagatatgtcagtgattgaagagcatgccaactggtctgtg
tcccgagaagcaggattcaactattcccacgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgacaaagaacagctccgagcaatttgtacacgagatcctctg
tctgaaatcactgagcaagaaaaagattttctgtggagccacaggcactattgtgtaact
atccctgaaattctgcccaaattgctcctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcctggtcaaagactggcctccaatcaaacctgaacaagccatggag
cttctggactgtaattacccagatcctatggttcgaggctttgctgttcgatgcctggaa
aaatatttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacctgcttgtgaggtttttacttaagaaagctttgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagta
agtcagaggtttggcctgcttttggagtcatattgtcgtgcttgtgggatgtatttgaag
cacctgaatagacaagttgaggctatggaaaagctgattaatttaactgacatcctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcaccaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttgcggcaagatatgttaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcggatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggcggcctgaaaggcgctctgcagttcaacagccacacactacaccagtgg
ctcaaagacaaaaacaaaggagaaatatacgatgcagccattgacttgttcacacgttcc
tgtgctgggtattgtgtcgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaagaaatttggttataaacgagaacgtgtaccatttgttttgacacaagatttc
ttaatagtcattagtaaaggagcccaagaatgcacaaaaacaagagaatttgaaagattt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccggaactacaatcttttgatgatattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacaccatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcacgctttgaactga

KEGG   Loxodonta africana (African savanna elephant): 100658340
Entry
100658340         CDS       T04351                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100658340 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100658340 (PIK3CB)
   04014 Ras signaling pathway
    100658340 (PIK3CB)
   04015 Rap1 signaling pathway
    100658340 (PIK3CB)
   04370 VEGF signaling pathway
    100658340 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100658340 (PIK3CB)
   04668 TNF signaling pathway
    100658340 (PIK3CB)
   04066 HIF-1 signaling pathway
    100658340 (PIK3CB)
   04068 FoxO signaling pathway
    100658340 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100658340 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100658340 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100658340 (PIK3CB)
   04024 cAMP signaling pathway
    100658340 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100658340 (PIK3CB)
   04152 AMPK signaling pathway
    100658340 (PIK3CB)
   04150 mTOR signaling pathway
    100658340 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100658340 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100658340 (PIK3CB)
   04218 Cellular senescence
    100658340 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100658340 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100658340 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100658340 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658340 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100658340 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100658340 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100658340 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100658340 (PIK3CB)
   04660 T cell receptor signaling pathway
    100658340 (PIK3CB)
   04662 B cell receptor signaling pathway
    100658340 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100658340 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100658340 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100658340 (PIK3CB)
   04062 Chemokine signaling pathway
    100658340 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100658340 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100658340 (PIK3CB)
   04929 GnRH secretion
    100658340 (PIK3CB)
   04915 Estrogen signaling pathway
    100658340 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100658340 (PIK3CB)
   04917 Prolactin signaling pathway
    100658340 (PIK3CB)
   04926 Relaxin signaling pathway
    100658340 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100658340 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100658340 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100658340 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100658340 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100658340 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100658340 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100658340 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100658340 (PIK3CB)
   04380 Osteoclast differentiation
    100658340 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100658340 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100658340 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658340 (PIK3CB)
   05206 MicroRNAs in cancer
    100658340 (PIK3CB)
   05205 Proteoglycans in cancer
    100658340 (PIK3CB)
   05203 Viral carcinogenesis
    100658340 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100658340 (PIK3CB)
   05231 Choline metabolism in cancer
    100658340 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100658340 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100658340 (PIK3CB)
   05212 Pancreatic cancer
    100658340 (PIK3CB)
   05225 Hepatocellular carcinoma
    100658340 (PIK3CB)
   05226 Gastric cancer
    100658340 (PIK3CB)
   05214 Glioma
    100658340 (PIK3CB)
   05221 Acute myeloid leukemia
    100658340 (PIK3CB)
   05220 Chronic myeloid leukemia
    100658340 (PIK3CB)
   05218 Melanoma
    100658340 (PIK3CB)
   05211 Renal cell carcinoma
    100658340 (PIK3CB)
   05215 Prostate cancer
    100658340 (PIK3CB)
   05213 Endometrial cancer
    100658340 (PIK3CB)
   05224 Breast cancer
    100658340 (PIK3CB)
   05222 Small cell lung cancer
    100658340 (PIK3CB)
   05223 Non-small cell lung cancer
    100658340 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658340 (PIK3CB)
   05017 Spinocerebellar ataxia
    100658340 (PIK3CB)
   05020 Prion disease
    100658340 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100658340 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100658340 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100658340 (PIK3CB)
   04931 Insulin resistance
    100658340 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100658340 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100658340 (PIK3CB)
   05135 Yersinia infection
    100658340 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100658340 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100658340 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100658340 (PIK3CB)
   05161 Hepatitis B
    100658340 (PIK3CB)
   05160 Hepatitis C
    100658340 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100658340 (PIK3CB)
   05164 Influenza A
    100658340 (PIK3CB)
   05162 Measles
    100658340 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100658340 (PIK3CB)
   05163 Human cytomegalovirus infection
    100658340 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658340 (PIK3CB)
   05169 Epstein-Barr virus infection
    100658340 (PIK3CB)
   05165 Human papillomavirus infection
    100658340 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100658340 (PIK3CB)
   05142 Chagas disease
    100658340 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100658340 (PIK3CB)
   01524 Platinum drug resistance
    100658340 (PIK3CB)
   01522 Endocrine resistance
    100658340 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100658340 (PIK3CB)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100658340 (PIK3CB)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100658340 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100658340
NCBI-ProteinID: XP_003420006
LinkDB
Position
Unknown
AA seq 1070 aa
MCINFIMPPAMADILDIWAVDSQITSDGSIPVDFLLPTGIYIQLEVPREATISHIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVKPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLIGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFTLVECCKIKKMYEQEMVAI
DAAINRSSSDLPLPLPPKKTRIISHVWENKHPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSAEISGKSDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDGANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGSLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcatcaacttcataatgcctcctgcaatggcagacattcttgacatctgggcagtg
gattcgcagataacatctgatggctccatacctgtggatttccttttgcccactgggatc
tatatccagttggaggtacctcgggaagctaccatttctcatattaagcagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgccgtatatgaggagctcgaagatgaaacaagaagactctgt
gatgtcaaaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggag
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattcagaagaaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttataggattgtcatggatggactggctgaagcaaacatatccaccagagcac
gaaccatccatccttgaaaacttagaagataaactttatggagggaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaatatgaatcct
ataaaaataaatgaattggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccttgtgactatgtgttgcaagtcagtgggagagtagaatatgtatttggtgat
catccgctgattcagttccagtatatccggaactgtgtaatgaacaggaccctgccccat
tttacacttgtggagtgctgtaagatcaagaagatgtatgaacaggaaatggttgccata
gatgctgccataaatcgaagttcatccgaccttcctcttcctttaccaccaaagaaaacg
cgaattatttctcatgtttgggaaaataagcaccctttccagattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcacgtcagggctggtctttttcacggt
actgagctcctgtgtaaaaccgtcgtaagtgcagagatatcagggaaaagtgatcacatt
tggaatgaaccactggaatttgatattaatacttgcgacctgccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagttaaaacgaagaaatcaactaaaactatt
aatccctctaagtatcaaaccatcaggaaagctggaaaagtgcattatcctgtagcctgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatattaaattcccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatggtgctaatgtatcaagtcgtggtggaaaaaagtttcttgctgtactaaaagaa
atcttggacagggatcccttatctcaactatgtgagaatgaaatggaccttatttggact
ttgcgacaagactgcagagagaatttcccacaatcactgccaaaattattgctgtctatc
aagtggaataaacttgaggatgttgctcagcttcaggcacttcttcagatttggcctaaa
ttgcccccccgggaggccctggagcttctggatttcaattatccagaccaatacgtgcgg
gaatatgctgtgggctgccttcaacagatgagcgatgaagaactctctcaatacctttta
cagctggtgcaggtgttgaaatacgagcctttcctggactgcgccctctctcggttcctg
ttagaaagggcgctggctaaccggaggatcgggcagtttctgttctggcatctgaggtca
gaagtacacatccctgctgtctcagtacaatttggtgtcatccttgaagcatactgtcgg
ggaagcgtaggccacatgaaagtgctttccaagcaggttgaagcactaaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagctaaacagagccaaagggaaggag
gccatgcacacctgtttaaaacagaatgcttaccgggaagccctctctgacctacagtcg
cctctgaacccatgtgtcatcctctcagaactctatgttgaaaagtgcaaatacatggat
tccaagatgaagcctttgtggctggtgtacaacaacaaagtgtttggtgaggattcagtc
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacacttcaaatgctg
cgcctgatggatctactctggaaagaagctggtctagatcttcggatgctgccttatggc
tgtttagcaacaggagatcgctctggcctgattgaagttgtgagcacctctgaaacaatt
gccgacattcagctgaacagtagcaatgtggcagctgctgcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattcaggggatgatctggaccgagctattgaggag
tttaccctgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaagaaaactggccagctcttccacattgactttggacat
attcttggaaacttcaagtctaaatttggcattaaaagggagcgagtgccttttatactt
acctatgatttcattcatgtcattcaacaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgatcttacgacggcatgggagtctcttc
atcactctgtttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatctcaaggattctcttgccttagggaagagtgaagaagaagcactcaaacaa
ttcaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtaaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Loxodonta africana (African savanna elephant): 100665045
Entry
100665045         CDS       T04351                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100665045 (PIK3R2)
   04014 Ras signaling pathway
    100665045 (PIK3R2)
   04015 Rap1 signaling pathway
    100665045 (PIK3R2)
   04370 VEGF signaling pathway
    100665045 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100665045 (PIK3R2)
   04668 TNF signaling pathway
    100665045 (PIK3R2)
   04066 HIF-1 signaling pathway
    100665045 (PIK3R2)
   04068 FoxO signaling pathway
    100665045 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100665045 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100665045 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100665045 (PIK3R2)
   04024 cAMP signaling pathway
    100665045 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100665045 (PIK3R2)
   04152 AMPK signaling pathway
    100665045 (PIK3R2)
   04150 mTOR signaling pathway
    100665045 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100665045 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100665045 (PIK3R2)
   04218 Cellular senescence
    100665045 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100665045 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100665045 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100665045 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100665045 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    100665045 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100665045 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100665045 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100665045 (PIK3R2)
   04660 T cell receptor signaling pathway
    100665045 (PIK3R2)
   04662 B cell receptor signaling pathway
    100665045 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100665045 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100665045 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100665045 (PIK3R2)
   04062 Chemokine signaling pathway
    100665045 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100665045 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100665045 (PIK3R2)
   04929 GnRH secretion
    100665045 (PIK3R2)
   04915 Estrogen signaling pathway
    100665045 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100665045 (PIK3R2)
   04917 Prolactin signaling pathway
    100665045 (PIK3R2)
   04926 Relaxin signaling pathway
    100665045 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100665045 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100665045 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100665045 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100665045 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100665045 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100665045 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100665045 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100665045 (PIK3R2)
   04380 Osteoclast differentiation
    100665045 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100665045 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100665045 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665045 (PIK3R2)
   05206 MicroRNAs in cancer
    100665045 (PIK3R2)
   05205 Proteoglycans in cancer
    100665045 (PIK3R2)
   05203 Viral carcinogenesis
    100665045 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100665045 (PIK3R2)
   05231 Choline metabolism in cancer
    100665045 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100665045 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100665045 (PIK3R2)
   05212 Pancreatic cancer
    100665045 (PIK3R2)
   05225 Hepatocellular carcinoma
    100665045 (PIK3R2)
   05226 Gastric cancer
    100665045 (PIK3R2)
   05214 Glioma
    100665045 (PIK3R2)
   05221 Acute myeloid leukemia
    100665045 (PIK3R2)
   05220 Chronic myeloid leukemia
    100665045 (PIK3R2)
   05218 Melanoma
    100665045 (PIK3R2)
   05211 Renal cell carcinoma
    100665045 (PIK3R2)
   05215 Prostate cancer
    100665045 (PIK3R2)
   05213 Endometrial cancer
    100665045 (PIK3R2)
   05224 Breast cancer
    100665045 (PIK3R2)
   05222 Small cell lung cancer
    100665045 (PIK3R2)
   05223 Non-small cell lung cancer
    100665045 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100665045 (PIK3R2)
   05017 Spinocerebellar ataxia
    100665045 (PIK3R2)
   05020 Prion disease
    100665045 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100665045 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100665045 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100665045 (PIK3R2)
   04931 Insulin resistance
    100665045 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100665045 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100665045 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100665045 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100665045 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100665045 (PIK3R2)
   05161 Hepatitis B
    100665045 (PIK3R2)
   05160 Hepatitis C
    100665045 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100665045 (PIK3R2)
   05164 Influenza A
    100665045 (PIK3R2)
   05162 Measles
    100665045 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100665045 (PIK3R2)
   05163 Human cytomegalovirus infection
    100665045 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665045 (PIK3R2)
   05169 Epstein-Barr virus infection
    100665045 (PIK3R2)
   05165 Human papillomavirus infection
    100665045 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100665045 (PIK3R2)
   05142 Chagas disease
    100665045 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100665045 (PIK3R2)
   01524 Platinum drug resistance
    100665045 (PIK3R2)
   01522 Endocrine resistance
    100665045 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100665045 (PIK3R2)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100665045 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 100665045
NCBI-ProteinID: XP_003413068
LinkDB
Position
Unknown
AA seq 730 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQNVGWMPGV
NERTRQRGDFPGTYVEFLGPVTLARPGPRPRGPRPLPARPRDGPSESGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSDSLYRPELPAPRTDWSLSDVEQWDAVALSDGVKGFLLA
LPAPLVTPEVAAEALRALREGAGPVGPALEPPTLPLHRALTLRFLFQHLGRVVRRAPALG
PAVRALAAVFGPLLLLHAPPPPSPPPGGAPDGIEPNPSPDFPVRLVEKLLQEYLEEQEVV
PPALPPKPPKAKPAPGGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDAS
SKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLD
TRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKR
TAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHES
RTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIK
NETEDQYSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACS
VVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALAVTLAHPVRA
PGPGPPPAAR
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggcaggcgctgagggcttccaataccgcgcactgtacccgttccgccgagagcggccc
gaggatctggagctgctgccaggggatgtgctggtggtgagccgggcggccctgcaggca
ctgggcgtggctgagggcggcgagcgctgcccacagaacgtgggctggatgcccggtgtc
aatgagcgcacacggcagcgcggtgacttccctggcacctacgtcgagttcctggggcct
gtgaccctggctcggcctggcccccgcccacgtggcccccgcccactacctgcccggccc
cgagatgggccctccgagtcaggcctcacactccctgacctgcctgagcagttctcccct
cccgacgtggcaccccccattctggtgaagctcgtggaggccattgagcggacagggctg
gacagtgactccctctacaggccggagctgcctgccccgcgcacagactggtccttgagc
gatgtggagcagtgggacgcggtggctctgtcggacggcgtcaagggcttcctgctggca
ctcccggcacccctggtgacgcccgaagtcgcggccgaggcgctccgggccctgcgggaa
ggcgcggggcccgtgggcccggcgctggagccaccgacgctgccgctgcatcgcgcgctc
acactgcgcttcctgttccaacacctgggtcgtgtagtcaggcgcgccccagccctaggt
cccgccgtccgcgccctggccgctgtcttcgggccgctgctgctcctgcacgcgccgccg
ccgccttcgccgccaccagggggtgcaccagacgggattgagcccaacccaagcccagac
ttccctgtgaggctggtggagaagttgcttcaggaatacctggaggagcaagaggtcgtt
cccccagcactgccgcctaaacctcccaaggcaaagccggcccccgggggcctggccaat
gggggcagcccaccctccctgcaggatgctgaatggtactggggggacatctccagggag
gaggtgaacgagaaactccgagacacacctgacggtactttcctggtccgagatgcatca
agcaagatccagggagagtacacgctgacactcaggaaaggcggcaacaacaagctgatc
aaggtgttccaccgtgatggccactatggcttctcggagccgctcaccttctgctccgtg
gtggacctcatcacccactaccgccatgagtcactggcccagtacaatgccaagctggac
acgcggctgctgtaccccgtgtccaagtaccagcaggaccagattgtcaaggaggacagc
gtggaggcggtgggcgcccagctcaaggtctaccaccagcagtaccaggacaagagccgc
gagtatgaccagctgtatgaggagtacacacgtacctctcaggagctacaaatgaagcgc
accgcaatcgaggccttcaacgaaaccattaagatctttgaggagcagggccagacgcaa
gagaaatgcagcaaggaatatctggagcgatttcggcgtgagggcaacgagaaggagatg
cagaggatcctgctgaactcagagcggctcaagtcccgcattgctgagatccatgagagc
cgcacgaagctggagcaggagctgcgggcgcaggcctcagacaaccgggagatcgataag
cgtatgaacagcctcaaacctgacctcatgcagctgcgcaagatccgagaccagtacctt
gtgtggctcacccaaaaaggtgcccggcaaaagaaaatcaacgagtggttggggatcaaa
aatgagactgaagaccagtattccctgatggaggacgaggacgaccttccacaccatgag
gaacggacgtggtatgtgggcaagatcaaccgcacacaggccgaggagatgctgagcggc
aagcgggacggcaccttcctcatccgtgagagcagccagcggggctgttacgcctgctct
gtggtggtagacggcgacaccaagcactgtgtcatctaccgcacagccactggctttggc
tttgcagagccctacaacctgtacgggtcactcaaggagctggtgttgcactaccagcac
gcctcactggtgcagcacaatgatgccctcgctgtcacactggcccaccctgtgcgtgcc
ccagggcctgggcccccacctgccgcccgctga

KEGG   Loxodonta africana (African savanna elephant): 100666266
Entry
100666266         CDS       T04351                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100666266 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100666266 (PIK3CD)
   04014 Ras signaling pathway
    100666266 (PIK3CD)
   04015 Rap1 signaling pathway
    100666266 (PIK3CD)
   04370 VEGF signaling pathway
    100666266 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100666266 (PIK3CD)
   04668 TNF signaling pathway
    100666266 (PIK3CD)
   04066 HIF-1 signaling pathway
    100666266 (PIK3CD)
   04068 FoxO signaling pathway
    100666266 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100666266 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100666266 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100666266 (PIK3CD)
   04024 cAMP signaling pathway
    100666266 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100666266 (PIK3CD)
   04152 AMPK signaling pathway
    100666266 (PIK3CD)
   04150 mTOR signaling pathway
    100666266 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100666266 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100666266 (PIK3CD)
   04218 Cellular senescence
    100666266 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100666266 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100666266 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100666266 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100666266 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    100666266 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100666266 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100666266 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100666266 (PIK3CD)
   04660 T cell receptor signaling pathway
    100666266 (PIK3CD)
   04662 B cell receptor signaling pathway
    100666266 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100666266 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100666266 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100666266 (PIK3CD)
   04062 Chemokine signaling pathway
    100666266 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100666266 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100666266 (PIK3CD)
   04929 GnRH secretion
    100666266 (PIK3CD)
   04915 Estrogen signaling pathway
    100666266 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100666266 (PIK3CD)
   04917 Prolactin signaling pathway
    100666266 (PIK3CD)
   04926 Relaxin signaling pathway
    100666266 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100666266 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100666266 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100666266 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100666266 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100666266 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100666266 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100666266 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100666266 (PIK3CD)
   04380 Osteoclast differentiation
    100666266 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100666266 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100666266 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666266 (PIK3CD)
   05206 MicroRNAs in cancer
    100666266 (PIK3CD)
   05205 Proteoglycans in cancer
    100666266 (PIK3CD)
   05203 Viral carcinogenesis
    100666266 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100666266 (PIK3CD)
   05231 Choline metabolism in cancer
    100666266 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100666266 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100666266 (PIK3CD)
   05212 Pancreatic cancer
    100666266 (PIK3CD)
   05225 Hepatocellular carcinoma
    100666266 (PIK3CD)
   05226 Gastric cancer
    100666266 (PIK3CD)
   05214 Glioma
    100666266 (PIK3CD)
   05221 Acute myeloid leukemia
    100666266 (PIK3CD)
   05220 Chronic myeloid leukemia
    100666266 (PIK3CD)
   05218 Melanoma
    100666266 (PIK3CD)
   05211 Renal cell carcinoma
    100666266 (PIK3CD)
   05215 Prostate cancer
    100666266 (PIK3CD)
   05213 Endometrial cancer
    100666266 (PIK3CD)
   05224 Breast cancer
    100666266 (PIK3CD)
   05222 Small cell lung cancer
    100666266 (PIK3CD)
   05223 Non-small cell lung cancer
    100666266 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666266 (PIK3CD)
   05017 Spinocerebellar ataxia
    100666266 (PIK3CD)
   05020 Prion disease
    100666266 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100666266 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100666266 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100666266 (PIK3CD)
   04931 Insulin resistance
    100666266 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100666266 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100666266 (PIK3CD)
   05135 Yersinia infection
    100666266 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100666266 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666266 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100666266 (PIK3CD)
   05161 Hepatitis B
    100666266 (PIK3CD)
   05160 Hepatitis C
    100666266 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    100666266 (PIK3CD)
   05164 Influenza A
    100666266 (PIK3CD)
   05162 Measles
    100666266 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100666266 (PIK3CD)
   05163 Human cytomegalovirus infection
    100666266 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100666266 (PIK3CD)
   05169 Epstein-Barr virus infection
    100666266 (PIK3CD)
   05165 Human papillomavirus infection
    100666266 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100666266 (PIK3CD)
   05142 Chagas disease
    100666266 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100666266 (PIK3CD)
   01524 Platinum drug resistance
    100666266 (PIK3CD)
   01522 Endocrine resistance
    100666266 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100666266 (PIK3CD)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100666266 (PIK3CD)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100666266 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_p85B PI3Ka PI3K_rbd PI3K_C2 DOCK-C2
Other DBs
NCBI-GeneID: 100666266
NCBI-ProteinID: XP_023408264
LinkDB
Position
Unknown
AA seq 997 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPFFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLV
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWEAWLQYSFPLQLEPVARGWGA
GTLRVPNRVLLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQLVERPEDYA
LQVNGKYEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAAQVQKLR
TKPPPIPVKKPSSASLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVSVCSGPVWNQRLEFDISICDLPRMARLCLALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGEHCLFMWPFVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
HPVYYPALDKVSLGQDLGWVGPPYQDLPCPEPMGSKGNFQGPASGASQSKVSATPCWTSA
PRPHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFL
FWHLRSEMHVPAVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVQLSSQKTT
KPQAKEMMHMCMRQETYLEALSHLQSPLDPSTLLADVCVEQCTFMDSKMKPLWIMYSNEE
AGSEGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEV
VLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATY
VLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKT
NNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKT
EEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 2994 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccctatggaattctggaccaaggaggagaaccagagcgtg
gcggttgacttcttgctgcccacgggtgtctatttgaacttccctgtgtcccgcaatgcc
aacctcagtaccatcaagcaggtgttgtggcaccgtgcccagtatgagcccttcttccac
atgctcagcgatcccgaggcctatgtgtttacctgcgtcaaccagacggcagaacagcag
gagctggaggacgagcagcgtcgactctgcgacatccagcccttcctgccggtcctgcgc
ctggtggcccgcgagggcgaccgtgtgaagaagctcatcaactcacagatcagcctcgtc
attggcaaaggcctccatgagttcgactccttgcgagacccggaggtgaatgactttcgc
accaagatgcgccagttctgcgaggaggcggctgcgcaccggcagcagctgggctgggag
gcctggctgcagtacagctttcccctgcagctggagcccgtagctcggggctggggtgct
ggcaccctgcgcgtccccaaccgggtcctcctggtcaatgtcaagtttgagggcagtgag
gagagcttcaccttccaggtgtccaccaaggacatgcccctggcactgatggcctgtgcc
ctccggaagaaggccactgtgttccggcagcagctggtggagcggccggaggactatgca
ctgcaggtgaacgggaagtacgagtacctctatggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtgcactcctcc
tccatcctggccatgcgggacgagcagagcaaccccgctgcccaggtccagaagctgcgc
accaagccaccccccattcctgtgaagaagccctcctctgcgtccctgtggtctctggag
cagccattttgcatcgagctgatccagggcagcaaagtgaatgccgacgagcgcatgaag
ctggtggtgcaggccgggcttttccatggcaacgagatgctgtgcaagatggtgtccagc
tcagaggtgagcgtgtgctcggggcccgtgtggaaccagcggctggagttcgacatcagc
atctgtgacctgccccgcatggcccggctctgccttgcactttatgcagtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgattataaagaccagctcaagaccggggagcactgcctcttc
atgtggccctttgtaccagacgagaaaggggaactgctaaaccccacagggactgtgcgg
agtaaccccaacacagagagtgctgctgccctggtcatctgcctccctgaggtggccccc
catcccgtgtactaccctgccctggacaaggtcagtttggggcaggacctcggctgggtt
ggacccccataccaggacctgccctgcccggagcctatggggtcaaaggggaactttcag
ggccctgcctcaggtgcttcccagagcaaggtctctgccaccccctgctggacttcagct
cccagaccgcacgtgggctccttcgccatcaagtccctgcgcaaactcacggacgatgag
cttttccagtacctgctgcagctggtgcaggtactcaagtatgagtcctacctcgactgt
gagctgaccaagttcctgctggaccgggcactggccaaccgcaagattggtcacttcctc
ttctggcatctccgctctgagatgcacgttccagcggtggccctgcgcttcggcctcatc
atggaggcctattgcaggggcagcacccaccacatgaaggtgctaatgaagcagggggaa
gcactgagcaaactgaaggccctgaacgactttgtccagctgagctcccagaagaccacc
aagccccaagccaaggagatgatgcacatgtgcatgcgtcaggagacctacctggaggct
ctctcccacctgcagtccccgctcgaccctagcaccctgctggctgatgtctgcgtggag
cagtgcaccttcatggactccaagatgaagcccttatggatcatgtacagcaatgaggag
gctggcagtgagggcagcgtgggcatcatcttcaagaacggggatgacctccgccaggac
atgctgactctgcagatgatccagctcatggatgttctgtggaagcaggaggggctggac
ctgaggatgaccccttatggctgcctctccactggggaccgcacaggcctcatcgaagta
gtgctccactcagacaccatcgccaacatccagctaaacaagagcaacatggcagccaca
gctgccttcaacaaggatgccctgctcaactggctcaagtccaagaacccgggggaggcc
ctggaccgagccatcgaggagtttaccctctcctgtgctggctactgtgtggccacctat
gtgctgggcattggcgatcggcacagtgacaacatcatgatccgtgaaagcgggcagcta
ttccacattgattttggccactttctggggaatttcaagactaagtttggaatcaaccgt
gaacgcgtcccgtttatcctcacctatgactttgtccatgtgattcagcaggggaagaca
aacaacagtgagaagtttgaaaggttcaggggctactgtgagagagcatacaccatcctg
cggcgccatgggctgctctttctccatctctttgccctcatgagagcagcaggcctgcct
gaactcagctgctccaaagacatccagtatctcaaggactccctggcgttggggaaaacg
gaagaggaagcactcaagcacttccgggtcaagtttaacgaagccctgcgagagagctgg
aaaaccaaagtgaactggctggcccacaacgtgtccaaagacaacaggcagtag

KEGG   Loxodonta africana (African savanna elephant): 100675496
Entry
100675496         CDS       T04351                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05142  Chagas disease
lav05146  Amoebiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100675496 (PIK3R3)
   04014 Ras signaling pathway
    100675496 (PIK3R3)
   04015 Rap1 signaling pathway
    100675496 (PIK3R3)
   04370 VEGF signaling pathway
    100675496 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100675496 (PIK3R3)
   04668 TNF signaling pathway
    100675496 (PIK3R3)
   04066 HIF-1 signaling pathway
    100675496 (PIK3R3)
   04068 FoxO signaling pathway
    100675496 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100675496 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100675496 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100675496 (PIK3R3)
   04024 cAMP signaling pathway
    100675496 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100675496 (PIK3R3)
   04152 AMPK signaling pathway
    100675496 (PIK3R3)
   04150 mTOR signaling pathway
    100675496 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100675496 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100675496 (PIK3R3)
   04218 Cellular senescence
    100675496 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675496 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100675496 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100675496 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675496 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    100675496 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100675496 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100675496 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100675496 (PIK3R3)
   04660 T cell receptor signaling pathway
    100675496 (PIK3R3)
   04662 B cell receptor signaling pathway
    100675496 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100675496 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100675496 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100675496 (PIK3R3)
   04062 Chemokine signaling pathway
    100675496 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100675496 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100675496 (PIK3R3)
   04929 GnRH secretion
    100675496 (PIK3R3)
   04915 Estrogen signaling pathway
    100675496 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100675496 (PIK3R3)
   04917 Prolactin signaling pathway
    100675496 (PIK3R3)
   04926 Relaxin signaling pathway
    100675496 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100675496 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100675496 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100675496 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100675496 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100675496 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100675496 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675496 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100675496 (PIK3R3)
   04380 Osteoclast differentiation
    100675496 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100675496 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100675496 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675496 (PIK3R3)
   05206 MicroRNAs in cancer
    100675496 (PIK3R3)
   05205 Proteoglycans in cancer
    100675496 (PIK3R3)
   05203 Viral carcinogenesis
    100675496 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100675496 (PIK3R3)
   05231 Choline metabolism in cancer
    100675496 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100675496 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100675496 (PIK3R3)
   05212 Pancreatic cancer
    100675496 (PIK3R3)
   05225 Hepatocellular carcinoma
    100675496 (PIK3R3)
   05226 Gastric cancer
    100675496 (PIK3R3)
   05214 Glioma
    100675496 (PIK3R3)
   05221 Acute myeloid leukemia
    100675496 (PIK3R3)
   05220 Chronic myeloid leukemia
    100675496 (PIK3R3)
   05218 Melanoma
    100675496 (PIK3R3)
   05211 Renal cell carcinoma
    100675496 (PIK3R3)
   05215 Prostate cancer
    100675496 (PIK3R3)
   05213 Endometrial cancer
    100675496 (PIK3R3)
   05224 Breast cancer
    100675496 (PIK3R3)
   05222 Small cell lung cancer
    100675496 (PIK3R3)
   05223 Non-small cell lung cancer
    100675496 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675496 (PIK3R3)
   05017 Spinocerebellar ataxia
    100675496 (PIK3R3)
   05020 Prion disease
    100675496 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100675496 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100675496 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100675496 (PIK3R3)
   04931 Insulin resistance
    100675496 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100675496 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100675496 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100675496 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100675496 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100675496 (PIK3R3)
   05161 Hepatitis B
    100675496 (PIK3R3)
   05160 Hepatitis C
    100675496 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    100675496 (PIK3R3)
   05164 Influenza A
    100675496 (PIK3R3)
   05162 Measles
    100675496 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100675496 (PIK3R3)
   05163 Human cytomegalovirus infection
    100675496 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675496 (PIK3R3)
   05169 Epstein-Barr virus infection
    100675496 (PIK3R3)
   05165 Human papillomavirus infection
    100675496 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100675496 (PIK3R3)
   05142 Chagas disease
    100675496 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100675496 (PIK3R3)
   01524 Platinum drug resistance
    100675496 (PIK3R3)
   01522 Endocrine resistance
    100675496 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100675496 (PIK3R3)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100675496 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Borrelia_P83 Fez1 DUF5638 Cupin_8 PI_PP_I
Other DBs
NCBI-GeneID: 100675496
NCBI-ProteinID: XP_023410460
LinkDB
Position
Unknown
AA seq 410 aa
MKESSAASLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNK
LIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKE
DNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAVEAFNETIKIFEEQCH
TQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREI
DKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFMNEEDENLP
HYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTAR
GYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaaggaaagttctgctgcttctcttcaggatgcagaatggtattggggggatatttca
agggaggaagtaaatgacaaattacgggacatgccagatggtacctttttggtccgagat
gcttcaacaaaaatgcagggagattatactttgactttgcggaagggaggcaataataag
ttaataaagatctatcatcgggatggtaaatatggcttttctgatcctctgacatttaat
tctgtggtggagctcattaaccactatcatcatgaatctcttgctcagtacaatcccaaa
cttgatgtgaagctgatgtacccagtgtccagataccaacaggatcagttggtaaaagaa
gataacattgatgcggtaggtaaaaaactgcaagaatatcactctcagtatcaggaaaaa
agtaaagagtatgacaggctgtatgaggaatatactaggacatcccaggaaatacagatg
aagaggactgcagttgaagcttttaatgaaacaattaaaatatttgaagaacagtgtcac
acacaagaacaacatagcaaagaatatattgagcgatttcgcagagaggggaatgaaaag
gagattgaacgaattatgatgaattacgacaaattgaaatcacgtctgggtgagatacat
gatagcaaaatgcgtctagagcaggatttgaagaaacaagctttggacaaccgggaaata
gataaaaaaatgaatagtatcaaacctgacctgatccagctgcgcaagatccgagatcag
caccttgtgtggctcaatcacaaaggagtaagacagaagcgtctgaatgcctggctggga
atcaagaatgaggatgccgatgagacctattttatgaatgaggaagatgaaaacttgccc
cattatgatgagaaaacctggtttgttgaggatatcaatcgagtacaagcagaagacttg
ctttatggaaaacctgatggtgcattcttaattcgagagagtagcaagaaaggatgctat
gcttgctctgtggttgccgatggggaagtgaagcactgtgtgatctacagcactgctcgg
ggctatggctttgcggagccctacaacctgtacagctccctgaaggagctcgtgctccat
taccagcagacatcccttgttcagcacaacgactccctcaatgtcaggctcgcctaccct
gtccacgcacagatgccatcgctctgcagataa

DBGET integrated database retrieval system