KEGG   Loxodonta africana (African savanna elephant): 100654024
Entry
100654024         CDS       T04351                                 

Gene name
GRIK1
Definition
(RefSeq) glutamate receptor ionotropic, kainate 1 isoform X5
  KO
K05201  glutamate receptor, ionotropic kainate 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100654024 (GRIK1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100654024 (GRIK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100654024 (GRIK1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100654024 (GRIK1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 PGM_PMM_II
Other DBs
NCBI-GeneID: 100654024
NCBI-ProteinID: XP_003410363
LinkDB
Position
Unknown
AA seq 905 aa
MERGTLLSQPGLWTRDTSWTLLYFLCCVLPQSAPQVLRIGGIFETVENEPVNVEELAFKF
AVTNINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLHPDYAAISRAVLDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHGTAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLKIDNPEVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLAVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKIGIWNSNSGLNMTDGNKD
RSNNISDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYD
VKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTVLVKN
SDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIG
EFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQR
KETVA
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggagcgcggcacactcctctcccagcctgggctctggaccagggacaccagctggaca
ctcctctatttcctctgctgcgtcctcccccagagcgcaccgcaagtactcaggatcgga
gggatttttgaaactgtggaaaatgaacctgttaatgttgaagaattagctttcaagttt
gcagtcaccaacatcaacagaaaccggaccctgatgcctaacaccacgttaacctatgac
atccagagaattaacctttttgatagttttgaagcctcacggagagcgtgtgaccagctg
gctcttggtgtggctgctctctttggtccttctcatagttcctccgtcagtgctgtgcaa
tctatctgcaatgctctcgaagttccgcacatacagacccgctggaaacatccgtcggtg
gataataaggacttgttttacatcaacctccatccagactatgcggctatcagcagagcg
gtcctggacctggtcctctattacaactggaagacagtgactgtggtgtatgaagacagt
acaggtctaattcgcctgcaggagctcatcaaagctccttccagatacaacattaaaatc
aaaatccgccagctgccctctgggaataaagatgccaagcctctgctgaaggagatgaag
aagggcaaggagttctatgtgattttcgactgttcccacggaacagccgctgaaatcctt
aagcagattctgttcatgggcatgatgacggagtactatcactactttttcacaaccctg
gacttgtttgctttagatctggaactctataggtacagcggcgtaaatatgactgggttt
cggctgcttaagattgacaaccctgaggtgtcctccatcattgagaagtggtccatggag
aggctgcaggccccacccagacccgagactggccttctggatggtatgatgacaactgaa
gcagccctgatgtacgatgcggtgtacatggtggccatcgcttcccaccgggcctcccag
ctggctgtcagctccctgcagtgccatcgacacaagccatggcgccttgggcccagattt
atgaacctgatcaaagaggctcggtgggatggcttgactgggcgtatcaccttcaataaa
accgatggcttgaggaaggattttgacttggacatcattagtctcaaagaggaaggaact
gaaaagattgggatttggaactccaacagtggactaaatatgacggatggcaacaaagac
aggtccaacaatatcagcgattcactggccaaccgaacgctgatcgtcaccaccattctg
gaagagccctatgtgatgtacaggaagtctgataagcccctatatggaaatgaccgattt
gaaggatattgcctggatctgttgaaggaattgtcaaatatcctgggtttcatttatgat
gtcaaactagtccctgatggcaaatatggagcccagaatgacaaaggagaatggaatggg
atggtcaaagaactcatagatcatagagctgacctggcggtggctcctctcaccatcact
tatgtgcgggagaaagtcattgacttctccaagcccttcatgaccctgggcatcagcatt
ctctaccggaagcccaatggtaccaatcctggggtcttctccttcctcaaccccttgtct
cctgacatttggatgtatgtgctcttggcctgcctgggggtcagttgtgtgctctttgtg
atcgcaaggtttacaccctacgagtggtataatccccacccatgcaaccctgactcagac
gtggtggaaaacaattttactttactaaatagtttctggtttggagttggagctctcatg
cagcaaggatcagagctgatgcccaaagctctatcgaccagaatagttggagggatatgg
tggtttttcaccctaatcatcatttcatcctataccgccaatctggctgccttcttgaca
gtggagagaatggagtcccccatagactcagctgatgatctggcaaagcaaaccaagatc
gaatacggggcggtcagagatggatcgacgatgaccttcttcaagaaatcaaagatatcc
acctacgagaagatgtgggcttttatgagcagcaggcagcagacagttctggtaaagaac
agcgatgaggggatccagcgagtgctcaccactgactacgcgctactgatggagtccacc
agcattgagtatgtgacccagagaaactgcaacctcactcagatcggaggactcattgac
tccaaaggttatggagtgggaacacctattggctctccttaccgggataagattaccatc
gctatccttcagctacaagaagaggggaaactgcatatgatgaaagaaaagtggtggcga
ggcaatggctgtcccgaggaagacagcaaagaggccagtgctctgggcgtggaaaacatt
gggggcatcttcattgtcctggccgctggactggtcctttctgtctttgtagccattgga
gaatttatatacaaatcaaggaagaacaatgacatcgaacagtgtctctctttcaatgcc
atcatggaagagctgggaatctcactcaagaatcagaaaaagttgaagaaaaagtcaaga
actaagggcaaatcttccttcacaagtatccttacttgccatcagagacgaactcagaga
aaagagactgtggcttga

KEGG   Loxodonta africana (African savanna elephant): 100661187
Entry
100661187         CDS       T04351                                 

Gene name
GRIK4
Definition
(RefSeq) glutamate receptor ionotropic, kainate 4
  KO
K05204  glutamate receptor, ionotropic kainate 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100661187 (GRIK4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100661187 (GRIK4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100661187 (GRIK4)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100661187 (GRIK4)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Other DBs
NCBI-GeneID: 100661187
NCBI-ProteinID: XP_003418245
UniProt: G3TIJ1
LinkDB
Position
Unknown
AA seq 956 aa
MPRVSAPLVLLPVWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDNLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTKNGFRQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVSELRSIVLCQDSVHPRRRRAGVPQPRPPIPEERRPRGTATLSNGKLCGAGEPDP
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPSRSEESLEWEKTTNSSEPE
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcctgtgtggctcgtgatggtcgcctgc
agcccgcactccctgaggatcgctgctatcctggacgatcccatggagtgcagcagaggg
gagaggctctccatcaccctggccaagaatcgcatcaaccgtgcccctgagaggctgggc
aaggccaaggtggaagtggacatctttgaacttctcagagacagcgaatacgagactgca
gaaaccatgtgtcagatcctccccaagggagtggttgctgtcctgggaccatcctccagc
cctgcctccagctccatcatcagcaacatctgtggggagaaggaggtccctcatttcaaa
gtggcccctgaggagtttgtaaagttccagttccagagattcacaaccctaaacctccac
cccagcaacaccgacatcagcgtggctgtagccggcatcctgaacttcttcaactgcacc
actgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctgctccgg
caattccttatctccaaggacacactctcagtccggatgctggacgacacccgggacccc
accccactcctcaaggagatccgggatgacaagacagccaccatcatcatccacgccaac
gcctccatgtcccacaccatcctcctcaaggcagctgaactagggatggtgtcagcctat
tacacatacatcttcactaatctggagttctcactccagagaatggacaaccttgtggat
gatcgtgtcaacatcctgggattttccattttcaaccagtcccatgctttcttccaagag
tttgcccagagcctcaaccagtcgtggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctctcctcggccttgctgtttgacgctgtctatgctgtggtgactgcggtgcag
gagctgaaccggagccaggagatcggcgtgaagcctctgtcctgcggctcggcccagatc
tggcagcacggcaccagcctcatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacatcgaattcaacagcaaaggccagagatctaactatgccctgaaaatcttacaa
ttcaccaagaacggttttcggcagatcggccagtggcatgtggcagagggcctcagcatg
gacagccgcctctacgcgtccaacatctccgacagtctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccga
ttcaactacaagatccgcctggtcggggatggtgtgtacggcgttcctgaggccaacggc
acctggacaggaatggtcggggagctgatcgctaggaaagcagatctggctgtggccggc
ctcaccattacggctgagcgggagaaggtgattgatttctctaagccattcatgactctg
ggaattagcattctttaccgagttcatatggggcgcaaacccggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgcttctagcctacctggctgtcagctgt
gtcctcttcctagtggctaggttgaccccctatgagtggtacagcccacacccatgcgcc
cagggccggtgcaacctcctagtgaaccagtactcccttggcaacagcctctggtttcca
gttgggggcttcatgcagcagggctctacaatcgccccccgcgccttgtccacccgctgt
gtcagtggcgtctggtgggccttcacgctgatcatcatctcatcctacacggccaatctg
gcagccttcctgaccgtgcagcgcatggatgtgcccatcgagtcagtggatgacctggct
gaccagactgccatcgagtatggcaccatccacggaggctccagcatgaccttttttcaa
aattctcgataccagacctaccaacgcatgtggaattacatgtattccaagcagccgagt
gtgtttgtgaagagcacggaggagggaattgccagggtgttgaattccaactacgccttc
cttctggagtccaccatgaatgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctcggttttccgg
gacgagtttgatctggccattctccagctgcaggagaacaaccgcttggaaatcctgaag
cgcaaatggtgggaagggggaaagtgccccaaggaggaagatcacagagccaaaggcctg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggcaatgttggagttcttatggactctccgacactcagaagcaactgaggtgtcc
gtctgccaggagatggtgagcgagctgcggagcatcgtcctgtgtcaggacagtgtccat
ccccggcggcggcgcgctggggtgccgcagccccgaccccccatccccgaggagcgccgg
ccccggggcacggccacgctcagcaacggcaagctgtgcggggccggagagcccgacccc
ctcgcccagagactggcccaggaggccgccctggtggcccgcggctgcacacacatccgg
gtctgccccgagtgccgccggttccagggcctgcgggcgcggccgtcgccctctcgcagc
gaggagagcctggagtgggagaagaccaccaacagcagcgagcccgagtag

KEGG   Loxodonta africana (African savanna elephant): 100662247
Entry
100662247         CDS       T04351                                 

Gene name
GRIK2
Definition
(RefSeq) glutamate receptor ionotropic, kainate 2 isoform X1
  KO
K05202  glutamate receptor, ionotropic kainate 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662247 (GRIK2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100662247 (GRIK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100662247 (GRIK2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100662247 (GRIK2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 100662247
NCBI-ProteinID: XP_003404370
LinkDB
Position
Unknown
AA seq 908 aa
MKIISPILSNPVFRRTIKLLLCLMWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKN
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgaagattatttccccgattctaagtaatccagtcttcaggcgcacaattaaactcctg
ctctgcttaatgtggattggatattctcaaggaaccacacatgtattaagatttggtggt
atttttgaatatgtggaatctggccccatgggagctgaggaactcgcattcagatttgct
gtgaacacaatcaacagaaacagaactttgttgcccaataccaccctaacctatgacact
cagaagataaacctctatgacagttttgaagcatccaagaaagcctgtgatcagctatct
cttggggtggctgccatcttcgggccatcgcacagctcatctgcaaatgcagtgcagtcc
atctgtaatgctctgggggttccccacatacagacgcgctggaagcaccaggtgtcagac
aacaaagattccttctatgtcagtctctacccagacttctcttcactcagccgtgccatt
ttggacttggtgcagtttttcaagtggaaaaccgtcacagtggtatatgatgacagcact
ggcctcattcgtttgcaagagctcatcaaagctccatcaagatataatcttcgactcaaa
atccgtcagttacctgctgatacaaaggatgcaaaacccttactaaaagagatgaaaaga
ggcaaggaattccatgtaatctttgactgtagccatgaaatggcagcaggcattttgaag
caggcattagctatgggaatgatgacggaatactatcattatatctttactactctggac
ctctttgctcttgatgttgagccctaccgatatagtggtgttaacatgacagggttcaga
atattaaatacagaaaatactcaagtttcctccattatcgaaaagtggtcaatggaacgg
ttgcaagcacctccgaaacccgattcaggtttgctggatggatttatgacgactgatgca
gccctaatgtatgatgctgtgcatgtggtgtccgtggcggtccagcagtttccccagatg
acagtgagttccttacaatgcaatcgacacaaaccctggcgctttgggacccgctttatg
agcctcattaaagaggcacactgggaaggcctaacaggtagaataacttttaacaaaacc
aatggtttacggacagattttgacttagatgtgatcagcctcaaggaagaaggtctcgaa
aagattggaacttgggatccagccagtggcctgaacatgacagaaagtcaaaagggaaag
ccagccaacatcacagattccttatccaatcgttctttgattgttactaccattttggaa
gaaccctatgtcctgtttaagaagtctgacaaacctctctatgggaatgaccgatttgag
ggctattgcattgacctcctcagagagctatctacaatccttggctttacatatgaaatt
agacttgtggaggatgggaaatatggagcccaggatgatgccaatggacaatggaatgga
atggttcgtgaactaattgatcataaagctgaccttgcggttgctccgttggctattacc
tacgttcgggagaaggtcatcgacttttccaagccctttatgacacttggaataagtatt
ttgtaccgcaagcccaatggtacaaacccaggcgtcttctccttcctgaatcctctctcc
cctgatatctggatgtatattctgctggcttacttgggtgtcagttgtgtgctctttgtc
atagccaggtttagtccctatgagtggtataatccacacccttgcaaccctgactcagac
gtggtggaaaacaattttaccttgctaaatagtttctggtttggagttggagctctcatg
cagcaaggttctgagctcatgcccaaagcgctctccaccaggatagtgggaggcatttgg
tggtttttcacacttatcatcatttcttcgtatactgctaacttagccgcctttctgaca
gtggagcgtatggaatcccccattgactctgctgatgatttagctaaacaaaccaagata
gagtatggagctgtggaggatggtgccaccatgacgttcttcaagaaatcaaaaatctcc
acatatgacaaaatgtgggcttttatgagtagcagaaggcagtcagtgctcgtcaaaaat
aatgaagaaggcattcagcgagtcctcacctctgattatgctttcctaatggagtcaaca
accatagagttcgtcactcaacgaaactgtaacctgacacagatcggcggccttatagac
tccaaaggttatggtgttggcactcccatgggttctccgtatcgagataaaatcaccata
gcgattcttcagcttcaagaagaaggcaagctgcacatgatgaaggagaagtggtggagg
ggcaatggttgtccagaggaggagagcaaagaagccagtgccctgggggttcaaaacatt
ggtggcatcttcattgttctggcagccggcttggtgctctcggtttttgtggcagtggga
gaatttttatacaaatccaaaaaaaacgctcaattggaaaagaggtccttctgtagcgcc
atggtggaagaactgaggatgtccctgaagtgccagcgtcggttaaaacacaagccacag
gccccagttattgtgaaaacagaagaagttatcaacatgcacacatttaacgacagaagg
ttgccaggtaaagaaaccatggcataa

KEGG   Loxodonta africana (African savanna elephant): 100665987
Entry
100665987         CDS       T04351                                 

Gene name
GRIK3
Definition
(RefSeq) glutamate receptor ionotropic, kainate 3
  KO
K05203  glutamate receptor, ionotropic kainate 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100665987 (GRIK3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100665987 (GRIK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100665987 (GRIK3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100665987 (GRIK3)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd ANF_receptor SBP_bac_3
Other DBs
NCBI-GeneID: 100665987
NCBI-ProteinID: XP_023410072
LinkDB
Position
Unknown
AA seq 867 aa
MTAPWRRLRSLVWEYWAGLLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKGECAASTCGHMHVCTCESVYPGV
HTRVFCAPWLSGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFD
CSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHV
SAIVEKWSMERLQAAPRTESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHR
HKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIVSLKEDGLEKVGVWSPAE
GLNITEVTKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKE
LAHILGFSYEIRLVEDGKYGAQDDKGQWNGMIKELIDHKADLAVAPLTITHVREKAIDFS
KPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWY
DAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISS
YTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMS
SKPSALVKNNEEGIQRTLTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMG
SPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGL
VLSVLVAVGEFVYKLRKTAEREQRSFCSTVADEIRFSLTCQRRVKHKPQPPMMVKTDAVI
NMHTFNDRRLPGKDSMTCSTSLAPVFP
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaccgctccctggcggcgcctccggagtctggtttgggaatactgggccgggctcctc
gtgtgcgccttctggatcccggactcgcgcgggatgccccacgtcatccggatcggaggg
atctttgagtatgcggatggccccaacgcccaggtcatgaacgcggaggaacacgccttt
cgattttctgccaacatcatcaacaggaacaggactctgctgcccaacacaaccttgacc
tacgacatccagaggatccactttcacgacagctttgaagccaccaagaagggtgagtgt
gcagcctcaacctgtggccacatgcacgtgtgtacatgcgagtctgtgtatccaggcgtg
cacacacgtgtattttgtgctccctggctctcagggctcatccggctgcaggagctcatc
atggccccgtcgaggtataacatccgcctgaagatccgccagctccccatcgactctgac
gactcgcggcccctgctcaaggagatgaagcgaggccgagaattccgcatcatcttcgac
tgcagccacaccatggcagcgcaaatcctcaagcaggccatggccatgggcatgatgacg
gagtactaccacttcatcttcaccactctggatctttatgcattagacctggagccctac
cgctactcaggggtcaacctgacaggcttccggatcctcaatgtggacaacccccacgtc
tcggccatcgtggagaagtggtccatggagcggctgcaggcggctccgcgaacagagtcg
ggcctgttggatggagtgatgatgactgacgcggccttactctatgacgccgtccacatt
gtatccgtgtgctaccagcgggctccccagatgactgtcaactccctgcagtgccatcgg
cacaaggcctggcgctttggtggccgcttcatgaacttcatcaaggaggctcaatgggaa
ggattaactggacggattgttttcaacaaaaccagtggcttacggacggatttcgatctg
gacattgtcagcctgaaggaggacggcctggagaaggttggagtgtggagtcctgctgag
ggactcaatatcacagaggtcaccaagggccgaggccccaacgtcactgactctctgaca
aacaggtcactcatcgtcaccacagtgctggaggagccctttgtcatgttccggaagtcc
gacaggaccctgtatgggaatgaccgcttcgagggctactgcatcgacctgctcaaggaa
ctggcccacatcctgggcttctcctacgagatccggctggtggaggatggcaagtacggg
gcacaggacgacaagggccagtggaacggcatgatcaaggagctcattgaccacaaggca
gatctggccgtggcccccctgaccatcacccatgtccgagagaaggccatcgacttctcc
aagcccttcatgacgcttggtgtgagcatcctgtatcgcaagcccaacggcaccaacccc
agtgtcttctccttcctcaaccccctgtctccagacatctggatgtacgtgctcctcgcc
tacctgggtgtcagctgtgtcctctttgtcattgccaggttcagcccttatgaatggtac
gacgctcacccctgcaaccccggctccgaggtggtggaaaacaacttcactctgctcaac
agcttctggttcgggatggggtccctcatgcagcaaggctctgaactgatgcccaaagct
ctgtccacccgaatcattggtggcatctggtggttcttcacactcatcatcatctcctcc
tacacggccaacctggctgcctttctgaccgtggagcggatggaatcacccatcgactct
gctgacgacctggccaagcaaaccaaaatcgagtatggggctgtcaaggatggagccaca
atgaccttcttcaagaagtccaagatctccaccttcgagaagatgtgggccttcatgagc
agcaaaccatcggcgctggtgaagaataacgaggagggcatccagaggacgctgacagcg
gactatgcactgctcatggagtccacgaccatcgagtatgtcacccagaggaactgcaac
ctcacccagattgggggcctcatcgactccaagggctacggcattggcacacccatgggc
tccccataccgggacaagatcaccattgccatcctgcagctgcaggaggaggacaagctg
cacatcatgaaggagaagtggtggcggggcagtggctgtcccgaggaggagaacaaggag
gccagcgccctgggtatccagaagatcgggggcatcttcattgtcctggctgctgggctg
gttctgtctgtgctggtggctgtgggcgagtttgtgtacaagctccgcaaaaccgcagag
cgagagcagcgttccttctgcagcaccgtggccgatgagatccgtttctccctcacttgc
cagcgtcgggtcaagcacaagccacaacctcccatgatggtcaagactgacgctgtcatc
aacatgcacacgttcaatgatcgccggcttccaggcaaggacagcatgacctgcagcaca
tcactggcccctgtattcccctag

KEGG   Loxodonta africana (African savanna elephant): 100668613
Entry
100668613         CDS       T04351                                 

Gene name
GRIK5
Definition
(RefSeq) glutamate receptor ionotropic, kainate 5
  KO
K05205  glutamate receptor, ionotropic kainate 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668613 (GRIK5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100668613 (GRIK5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100668613 (GRIK5)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100668613 (GRIK5)
SSDB
Motif
Pfam: ANF_receptor Lig_chan-Glu_bd Lig_chan SBP_bac_3
Other DBs
NCBI-GeneID: 100668613
NCBI-ProteinID: XP_023399781
LinkDB
Position
Unknown
AA seq 846 aa
MSWSLPLPELPPPPAVLQEGSVTPWAGGLPTGGEWGPRQLRPHEEGRKMPAELLLLLIVA
FASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQR
DSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLR
FASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRM
LDDSRDPTPLWDEALPTSVCGSLSLAWPLCISCVPQASELGMTSAFYKYILTTMDFPILH
LDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGPALSAALMFDAVHV
VVNAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNY
TLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPN
FQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKA
DLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLA
YLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPR
ALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGS
TMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLN
CNLTQIGGLLDTKGYGIGMPLGMAARVEGGGAPCIRNQDVGAGWGLGQALSEANSVSVRL
CLASGR
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgtcctggagtctgcccctacctgagttaccgccccctccagctgtcctccaggagggc
tcagtcaccccctgggccgggggtctccctacaggtggcgagtgggggccgcggcagctg
cgtccccatgaggaggggaggaagatgccggctgagctgctgctgctgctgattgttgcc
ttcgccagccccagctgccaggtgctctcatcactgcgcatggctgcaatcctggacgac
cagacagtgtgtggccgaggtgagcgtctggccctggccctggcccgggagcagatcaac
gggatcatcgaggtcccagccaaagcccgagtggaagtagacatctttgagctgcagcgg
gacagccagtacgagaccacggacaccatgtgtcagatcctgcccaagggggtcgtgtct
gtcctaggaccttcgtccagccctgcatctgcatctaccgtgagccatatctgtggggag
aaggagatccctcatatcaaggtaggccctgaggagacaccccgccttcagtaccttcgc
tttgcgtctgtcagcctgtaccccagcaacgaggacgtcagcctggctgtctcccgaatc
ctcaagtctttcaactatccctcggccagcctcatctgcgccaaggctgagtgcctgctg
cgattggaggaactggtgcgcgggttcctcatctctaaggagacgctgtcggtgaggatg
ctggacgacagccgagaccccacgccactgtgggatgaggctctccccacctcggtctgt
gggtctctgtctctcgcgtggcctctttgcatctcctgtgtcccccaggcctcggagctg
ggaatgacctcagcgttttacaagtacatcctcaccaccatggacttccccatcctgcat
ctggacggtatcgtggaggactcctccaacatcctgggcttctccatgttcaacacctcc
caccccttctaccccgagttcgtgcgcagccttaacatgtcctggagggagaactgtgaa
gccagcacctatccgggccctgcgctctcagctgccctgatgttcgacgctgtgcatgtg
gtagtgaatgctgtccgagagctgaaccgcagccaggagattggtgtcaaacctctggcc
tgtacatctgccaacatttggccccacgggaccagcctcatgaactatctgcgcatggta
gagtatgatgggctgaccgggcgggtcgaattcaacagcaaagggcagaggaccaactac
accctgcgcatcctggagaagtcccggcagggccaccgcgagattggggtgtggtactct
aaccggaccctagccatgaatgccaccacactggacatcaacctgtcacagacgttggcc
aacaagacactggtggtcaccaccatcctggagaacccgtacgtcatgcgccggcccaac
ttccaggccctgtcggggaacgagcgcttcgagggcttctgcgtggacatgctgcgggag
ctggcggagctgctgcgctttcgctaccgcctgcggctggtagaggacgggctgtacgga
gcgcccgagcccaatggctcctggacgggcatggttggcgagctcatcaaccggaaggca
gacctggctgtggctgcgttcaccatcacggccgagcgggagaaggtcatcgacttctct
aagcccttcatgaccctggggatcagcatcctctaccgcgtgcacatgggccgcaagcct
ggttacttctccttcctggaccccttctcccctgctgtgtggctcttcatgcttctcgcc
tacctggctgtcagctgtgtactattcctggccgccaggctgagcccctacgagtggtat
aacccgcatccgtgtctgcgggcgcgcccccacatcctggagaaccagtacacgctgggc
aacagcctctggtttcccgtggggggcttcatgcagcagggctcggagatcatgccccgg
gcgctgtccacgcgctgcgtcagcggagtctggtgggccttcaccttgatcatcatctcc
tcctacacggccaacctggccgccttcctcaccgtgcagcgcatggaggtgcctgtggag
tcggccgacgacctggcagatcagaccaacattgagtatgggaccatccatgctggctcc
accatgaccttcttccagaattcgcggtaccagacataccagcgtatgtggaactacatg
cagtcgaagcagcccagtgtgttcgtcaagagcacggaagagggcatcgcccgtgtcctc
aactcccgctatgccttcctgcttgagtccaccatgaatgagtaccaccggcgcctcaac
tgcaacctcacccagatcgggggcctcctcgataccaagggctatggcattggcatgccg
cttggtatggcagctcgtgtggaagggggtggggccccgtgcatcagaaaccaagacgtg
ggagcaggctggggactgggccaggccctctctgaggcaaactctgtgtctgtgcgtttg
tgtttggcctcaggcaggtga

DBGET integrated database retrieval system