KEGG   Loxodonta africana (African savanna elephant): 100655238
Entry
100655238         CDS       T04351                                 

Gene name
NR4A2
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 2 isoform X4
  KO
K08558  nuclear receptor subfamily 4 group A member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04925  Aldosterone synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100655238 (NR4A2)
   04925 Aldosterone synthesis and secretion
    100655238 (NR4A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655238 (NR4A2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100655238 (NR4A2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    100655238 (NR4A2)
Nuclear receptors [BR:lav03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   100655238 (NR4A2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100655238
NCBI-ProteinID: XP_003405887
LinkDB
Position
Unknown
AA seq 535 aa
MDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYK
PSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPP
GTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQL
LDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK
NCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVS
LISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEK
IPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWI
DSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNN
GGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggacaactacagcacaggctacgacgtcaagccaccttgcttgtaccaaatgcccctg
tccggacagcagtcctccattaaggtagaagacattcagatgcacaactaccagcaacac
agccacctgcccccccagtccgaggagatgatgccgcactccgggtcggtttactacaag
ccctcttcgcccccgacgcccaccaccccgggcttccaggtgcagcacagccccatgtgg
gacgacccggggtccctccacaacttccaccagaactacgtggccaccacgcacatgatc
gagcagaggaaaacgccggtctctcgcctttccctcttctcctttaagcagtcacccccg
ggtacccctgtgtccagctgccagatgcgcttcgatgggcccctgcacgtccccatgaac
ccggagccggcgggcagtcaccacgtggtggacgggcagacgtttgctgtgcccaatcct
atccgcaagcccgcgtccatgggcttcccgggcttgcagatcggccacgcgtcgcagctg
ctcgacacgcaggtgccctcgccgccgtcgcggggctccccttccaacgaggggctgtgc
gctgtgtgcggcgacaacgcggcctgccaacactatggcgtgcgcacctgcgagggctgc
aaaggcttttttaagcgcacggtgcagaaaaacgcaaaatacgtgtgtttagcaaataaa
aactgcccagtagacaagcggcgccggaatcgctgtcagtactgccgatttcagaagtgc
ctggctgttggaatggtcaaagaagtggttcgcaccgacagtttaaaaggccggagaggt
cgtttgccctcgaaaccgaagagtccccaggagccctctcccccctcgcccccggtgagt
ctgatcagtgccctcgtgagggcccatgtcgactccaacccggctatgaccagcctggac
tattccaggttccaggcgaaccctgactatcaaatgagtggagatgacacccagcatatc
cagcaattctatgacctcctgactggttccatggagatcatcaggggctgggctgagaag
atccctggcttcgcagacctgcccaaagcagaccaagacctgcttttcgaatcagctttt
ctagaactgtttgttctgagattagcttacaggtccaacccagtggagggtaaactcatc
ttttgcaatggggtggtcttgcacaggttgcaatgcgtgcgtggctttggggaatggatt
gattccattgttgaattctcctccaacttgcagaatatgaacatcgacatttctgccttc
tcctgtattgctgccctggctatggtcacagagagacatgggctcaaggaacccaagaga
gtggaagagttgcagaacaagattgtaaattgtctcaaagaccacgtgactttcaataac
ggggggttgaatcgccccaactatttgtccaaactcttggggaagctcccagaactccgt
accctttgcacacaggggctacaacgcattttctacctgaaactggaagacttggtacca
ccaccagcaataattgacaaacttttcctggacactttacctttctaa

DBGET integrated database retrieval system