KEGG   Loxodonta africana (African savanna elephant): 100655453
Entry
100655453         CDS       T04351                                 

Gene name
CHRNA6
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-6
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100655453 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100655453 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100655453 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100655453 (CHRNA6)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100655453 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 100655453
NCBI-ProteinID: XP_023406836
LinkDB
Position
Unknown
AA seq 426 aa
METNLWLRHIWNDYKLRWDPMEYDGIETLRIPVDKIWKPDIVLYNNAVGDFQVEGKTKAL
LKYDGTITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMND
FWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTVNLIIPCLFISFLTV
LVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIV
VTVFVLNIHYRTPTTHTMPKWVKTVFLQLLPQILMMRRPLDKMKETRSDKNRKGISSKPT
KVKFANCREPNLKECCHCNKTRELTTTSKRRLSHRPLQWMTENLEHSPEVEDVINSVHFI
AENMKNQNETKEVNTCLFWPAQSSPLAGLEIRYRHGQIISVRSVYKRPSGSFILRSGFLI
MQLCVE
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggaaaccaatctgtggctgcgtcatatctggaatgattataaattgcgatgggatcca
atggagtatgatggcattgagactcttcgtattcctgttgataagatttggaagcctgac
attgttctctataacaatgctgttggcgacttccaagtggaaggcaagacaaaagctctt
cttaaatacgatggcacgataacctggactccaccagctatttttaagagttcctgtcct
atggatatcaccttcttcccttttgatcatcaaaattgttccctgaaatttggttcctgg
acatatgacaaagctgaaatcgatcttctaattattggctctaaagtagatatgaatgat
ttttgggaaaatagtgaatgggaaattgttgatgcttctggctacaagcatgacataaag
tataactgttgcgaagagatatacacagatataacctattctttttacattagaagactg
ccaatgttttatactgttaatctgattatcccctgtctctttatttcatttctaactgtg
ttggtcttttatcttccttccgactgtggtgaaaaagtgacactttgcatttcggttctg
ctttctctgactgtgttcttgctggtcatcacagaaaccatcccgtccacgtctcttgtg
atcccactggtaggtgagtacctactgttcaccatgatctttgtcaccctatccatcgtg
gtgacagtctttgtgttgaacatacactatcgtactccaaccacacacaccatgcccaag
tgggtaaagacagttttccttcagctgttaccccagatcctgatgatgaggaggcctctg
gacaagatgaaggagacacgttctgataaaaaccgcaaaggtatttccagtaaaccaaca
aaagtcaagtttgctaactgcagagagcccaatcttaaagagtgctgccattgtaataaa
acaagggagcttaccaccaccagcaagagaagattaagtcatcggcctttacaatggatg
actgaaaatttggagcactcccctgaagttgaagatgtgattaacagtgttcatttcatt
gcagaaaacatgaagaaccaaaatgaaacaaaggaggtaaatacatgtctcttctggcct
gcccagtcttcacccttagcaggcttagagatacgttatagacatggtcagattataagt
gtgaggtctgtttacaagaggccgtcaggcagctttattctaaggtccggctttcttatt
atgcagctatgtgtggagtga

KEGG   Loxodonta africana (African savanna elephant): 100656157
Entry
100656157         CDS       T04351                                 

Definition
(RefSeq) CHRNA7-FAM7A fusion protein
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05033  Nicotine addiction
lav05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656157
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656157
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100656157
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100656157
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656157
   05022 Pathways of neurodegeneration - multiple diseases
    100656157
  09165 Substance dependence
   05033 Nicotine addiction
    100656157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656157
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100656157
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD SUR7
Other DBs
NCBI-GeneID: 100656157
NCBI-ProteinID: XP_023395423
LinkDB
Position
Unknown
AA seq 321 aa
MQEADISSYIPNGEWDLVGIPGKRSEKFYDCCKEPYPDVTFTVTMRRRTLYYGLNLLIPC
VLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM
IIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQ
RRCSLASVEMNAMAGPPTSNGNLLYLGFRGLDTVHCAPTPDSGVVCGRMACSPTHDGHLL
HGGQPAEGDPDLAKILEEVRYIANRFRCQDESEAICSEWKFAACVVDRLCLMAFSIFTII
CTIGILMSAPNFVEAVSKDFA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaggaggcagacatcagcagctacatcccgaatggagagtgggatcttgtgggaatc
cccgggaagaggagtgagaagttctatgactgctgcaaagagccatacccagatgtcacc
ttcacagtgaccatgaggcgcaggaccctctactatggcctcaacctgctcatcccctgt
gtgctcatctctgccttggccctgttagtgttcctgctgcctgcagactctggcgagaaa
atctccctggggataacggttttactttctctgactgtcttcatgctgcttgtggctgag
atcatgcctgcgacgtccgattcagtgccattgattgcccagtattttgccagcaccatg
atcattgtcggcctctctgttgttgtgacggtgatcgtgctgcagtaccaccaccacgac
cctgatgggggcaagatgcccaagtggaccagagtcatcctcctgaactggtgtgcctgg
ttcctgcgcatgaaaaggccaggggaggacaaggtgcgtcccgcctgccagcacaagcag
cgccgctgcagcctggccagtgtggagatgaatgccatggctgggccacccaccagcaat
gggaacctactctaccttggcttccgtggcctggacaccgtgcactgtgccccaacacct
gactctggggtcgtgtgtggccgcatggcctgctcgcccacacatgatgggcacctccta
catggtgggcagcctgcagagggcgacccggacctggccaagatcctggaggaggtccgc
tacatcgccaaccgcttccggtgccaggatgagagtgaggccatctgcagcgaatggaag
tttgcagcctgcgtggtcgaccgtctttgcctcatggccttctccatcttcaccatcatc
tgcaccatcggcatcctgatgtcggctcccaacttcgtcgaggccgtgtccaaagatttt
gcttag

KEGG   Loxodonta africana (African savanna elephant): 100664510
Entry
100664510         CDS       T04351                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100664510 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100664510 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100664510 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100664510 (CHRNA4)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100664510 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 100664510
NCBI-ProteinID: XP_003421811
UniProt: G3SW60
LinkDB
Position
Unknown
AA seq 614 aa
MELGGAGAPPPLPPLLLLLGASLLPASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVSMHRRVDQLDYWESGEWVIVDAVGNYNTKKYECCAEVYPDITYAFIIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLLMKR
PSVVKDNCWQLIESVHKMANAPHFWPEPEGQPGVPRRDPSPSESFCTSLGEPVKPPSEQP
PDLHPAEARKASACPSPGPGHLLSSSQATGLAKTRSLSVQHMPSPSKVEYGGVRCRSRSV
QYGIFRDDASAQANGQVASAPPSTCSAEPTAPDQPSPCKCKCKKEPPATSPDATAHSTKV
PCRHLPLTPALARAVEGVQYIADHLKAEDMDFSVKEDWKYVAMVIDRIFLWVFVLVCLLG
TVGLFLPPWLAGMI
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggagcttgggggcgccggggcaccgccgccgctaccgccgctgctgctgcttctcggg
gccagcctcctgcccgcgagcagccacgtggagacccgagcccacgccgaggagcggctg
ctgaagaaactcttctctggctacaacaagtggtcccggcctgtggccaacatctcggac
gtggtcctggtccgctttggcctgtccattgcccagctcattgacgtggacgagaagaac
cagatgatgaccactaacgtgtgggtgaagcaggagtggcatgactacaagctgcgctgg
gacccggccgactacgagaatgtgacatccatccgcatcccctcagagctcatctggcgg
ccggacattgtcctctacaataatgcggatggggacttcgcagtgacacacctgaccaaa
gcccacctcttccacgacgggcgggtccagtggacacccccagccatctacaagagctcc
tgcagcatcgatgtcaccttcttccccttcgaccagcagaactgcaccatgaagtttggg
tcctggacatacgacaaggccaagatcgacctggtgagcatgcaccgacgcgtggaccag
ctggactactgggagagtggcgagtgggtgatcgtggatgccgtgggcaactacaacacc
aagaagtacgagtgctgcgccgaggtctaccctgacatcacctacgccttcatcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccgtccgagtgtggcgagaaggtcacgctctgcatctcc
gtgctgctctcgctcaccgtcttcttgctgctcatcaccgagatcatcccgtccacctcg
ctggtcatcccgctcatcggcgagtacctgctcttcaccatgatcttcgtcacgctctcc
atcatcatcaccgtctttgtgctaaacgtgcaccaccgctcgccgcgcacacatactatg
cctgcctgggtgcgcagggtcttcttggacatcgtgccccgcctgctcctcatgaagcgg
ccatctgtggtcaaggacaactgctggcagctcatcgagtctgtgcacaagatggccaat
gctccacacttctggccagagcctgagggccagcccggtgtcccgaggcgagacccgtcg
ccctctgaatccttctgcacctccctgggggagccggtcaagccaccctcagaacaaccc
cctgatctccaccccgcagaggccaggaaggccagcgcctgcccctcacctggccctggc
cacctgctcagcagcagccaggccacagggctggccaaaaccaggtctctgagtgtccag
cacatgcccagccccagcaaggtggagtatggtggtgtccggtgccggtctcgaagtgtc
cagtatggcatcttccgagatgatgcctctgctcaggccaatgggcaggtggccagtgcc
ccaccttccacgtgctctgccgagcccacagccccagaccagccctctccctgcaaatgc
aagtgcaagaaggagccacctgccacctcccctgatgccacagcccacagcaccaaagtg
ccatgccgccacctgcccctgacaccagccctggctcgggctgtggagggcgtccagtac
atcgcagaccacctaaaggcagaggacatggatttctcggtgaaggaagactggaagtac
gtggccatggtcatcgaccgcatcttcctctgggtgtttgtcctcgtctgtctgctgggc
accgtcggcctcttccttccgccctggctggctggcatgatctag

KEGG   Loxodonta africana (African savanna elephant): 100674530
Entry
100674530         CDS       T04351                                 

Gene name
CHRNB4
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-4
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674530 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100674530 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100674530 (CHRNB4)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100674530 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417 SUZ
Other DBs
NCBI-GeneID: 100674530
NCBI-ProteinID: XP_003413789
LinkDB
Position
Unknown
AA seq 493 aa
MRSAHSLVLFSLVVLYGRGNCRVANAEEKLIEDLLNKTRYNNLIRPAASSSELISIQLQL
ILAQLISVNEREQIMTTNIWLKQEWTDYRLAWNSSRYEGVNILRIPAKRVWLPDIVLYNN
ADGTYEVSVYTNVVVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDYTE
IDMVLKTPTADMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLITSLAILVFYLPSNCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHVMAPWVKRCFLHKLPTFLFMKRPNSSPTRAPQP
SQSHLTKTEATSSTVGPAIPSNFYENSMYFVNPASAAPKSPAGADSAGIPRDLRLRASGR
FQQDVQEALEGVSFIAQHMKSDDQDQSVIEDWKFVAMVVDRLFLWVFVFVCVLGTVGLFL
PPFFQTHLPTEGS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaggagcgcgcacagcctggttctgttctccctggttgtcctttacgggcgcgggaac
tgccgtgtggccaatgccgaggagaagctcatagaagatcttctgaacaaaacccgttac
aacaacctgatccgtccagccgccagctcctccgagctcatctccatccagctccaactt
atcctggcccagcttatcagtgtgaatgagcgagaacagatcatgaccaccaacatctgg
ctgaaacaggaatggacagattaccgcctggcctggaacagctcccgctacgagggcgtc
aacatcctgaggatccctgcaaagcgcgtctggctgcctgacattgtgctgtataacaac
gctgatgggacctacgaggtatcagtctacaccaatgtggtggtccgctccaatggcagc
atccagtggttgccccctgccatctataagagcgcttgcaagattgaggtgaagcacttc
cccttcgaccagcaaaactgcaccctcaaattccgctcctggacctacgactacacagag
atcgacatggtactcaagacacctacagccgacatggatgactttactcccagtggtgag
tgggacatcgtggccctcccggggcgaaggacagtgaacccgcaggaccccagctacgtg
gatgtgacttacgacttcatcatcaaacgcaagccactcttctataccatcaacctcatc
atcccttgtgtgctcatcacctcattggccatccttgtcttctacctgccctccaactgc
ggtgagaagatgacgctgtgcatctccgtgctgctggctctcaccgtcttcctgctgctc
atttccaagattgtgccacccacctccctggacgtgccactcattggcaaatacctcatg
ttcaccatggtgctggtcaccttctccattgtcaccagcgtctgtgtgctcaacgtgcac
caccgctcgcccagcactcacgtcatggcaccctgggtcaagcgctgcttcctacacaag
ctgcccaccttcctcttcatgaagcgccccaacagcagccccaccagggccccccagccc
agtcagtcgcacctgaccaagaccgaggccacctcctccaccgtgggccctgccatcccc
tccaacttctacgagaattccatgtattttgtgaatcctgcctctgcagctcccaagtct
ccagctggtgctgactcggcaggaatccccagggatctccggctgagggcctctgggagg
ttccagcaggatgttcaggaggccttggagggtgtcagcttcattgcacagcacatgaag
agtgacgatcaagaccagagtgtcattgaggactggaagtttgtggccatggtggttgac
cggctgttcctgtgggtgttcgtgtttgtgtgtgtgctgggcacagtggggctcttcctg
cctcccttcttccagacccacctgcccaccgaggggtcctag

KEGG   Loxodonta africana (African savanna elephant): 100674819
Entry
100674819         CDS       T04351                                 

Gene name
CHRNA3
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-3 isoform X2
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674819 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100674819 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100674819 (CHRNA3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100674819 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 100674819
NCBI-ProteinID: XP_010592191
LinkDB
Position
Unknown
AA seq 438 aa
MSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYNGVEFMRVPAEKIWKPDIVLYNNA
VGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSHDKAKI
DLVQISSSMNLKDYWESGEWAIISAPGYKHYIKYNCCEEIYPDITYSLYIRRLPLFYTIN
LIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEY
LLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKTIFLNLLPRIMFMTRPAGNEGNTQ
KPRPFYNAELSNMNCFSHAESKGCKEGYPCQDGMCGFCHHRRIKISNFSANLTRSSSSES
VDAVLSLSALSPEIKEAIESVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFILVC
ILGTAGLFLQPLMSRDDV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtctcagctagtgaaggtggatgaagtaaaccagatcatggagaccaacctgtggctg
aagcaaatctggaatgactacaagctgaagtggaacccctctgactacaacggggtagag
ttcatgcgcgtccccgcagagaagatctggaagccagacattgtgctgtataacaatgct
gttggggatttccaggtggacgacaagaccaaagccttactcaagtacaccggggaagtg
acttggatacctcccgccatctttaagagctcatgcaaaattgacgtgacctactttcca
tttgattaccaaaactgcaccatgaagtttggttcctggtcccacgacaaagcaaaaatc
gacctggtccagatcagctcctccatgaacctcaaggactactgggagagtggcgagtgg
gccatcatcagtgccccaggctacaaacactacatcaagtacaactgctgcgaggagatc
tacccagatatcacgtactcgctgtacattcggcgcctgcccctgttctacaccatcaac
ctcatcatcccctgcctgctcatctccttcctgactgtgctcgtcttctacctgccctcc
gactgcggcgagaaggtgacgctctgcatctcagtcctcctctccttgaccgtgtttctc
ctggtgatcactgagacaatcccatctacctctttggtcattcccctgattggcgagtac
cttctgttcaccatgatttttgtaaccctctccattgtcatcaccgtctttgtactcaac
gtgcactacagaaccccaaccacgcacacaatgcccacgtgggtcaagaccatattcctc
aacttgcttcctaggataatgttcatgaccaggccggcaggcaatgagggcaacactcag
aaaccaagacccttctacaatgctgagctctcaaatatgaactgcttcagccatgcagag
tccaaaggctgcaaggaaggctatccctgccaggatgggatgtgtggtttctgccaccac
cgcaggataaaaatctcaaatttcagtgccaacctcaccagaagctccagttctgagtct
gttgatgctgtgctctccctctctgctttgtctccagaaatcaaagaagctatcgagagt
gtcaagtatattgctgaaaatatgaaggcacaaaatgaagccaaagagattcaagatgat
tggaagtacgttgccatggtgattgatcgtatttttctgtgggtcttcatcctggtgtgc
attttagggacagcaggattgtttctgcaacccttgatgtccagggatgacgtataa

KEGG   Loxodonta africana (African savanna elephant): 100677002
Entry
100677002         CDS       T04351                                 

Gene name
CHRNB2
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-2
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100677002 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100677002 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100677002 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100677002 (CHRNB2)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100677002 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 100677002
NCBI-ProteinID: XP_003415151
UniProt: G3TIU2
LinkDB
Position
Unknown
AA seq 500 aa
MAGRCGPMALLLSFGLLGLCPGARGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSDVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAEASFFFREVPGADSCTCFVNRASVQGLAGAFGAEPPQVAGPGGPCGC
GLREAVDGVRFIADHMRSEDEDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPL
FQNYTTTTFLHPDHSAPSSK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggccgggcgctgcggccccatggcgctgcttctcagctttggcctcctcgggctgtgc
ccaggggccaggggtacagataccgaagagcggctggtggagcatctcctggacccttct
cgctacaacaagctcatccgtccagctaccaatggctctgagctggtgacggtacagctc
atggtatcattggcccaacttatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaggattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccatctaagcacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaacgctgtggtctcctatgac
ggtagcatcttctggctgccacccgccatctataagagcgcatgcaagatcgaggtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgctcctggacctacgaccgc
accgagatcgacctggtgctcaaaagtgacgtggccagcctggacgacttcacacccagc
ggtgagtgggacatcgtggcactgccgggccggcgcaacgagaaccccgatgactccacc
tacgtggacatcacgtatgacttcatcatccgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgcgtgctcatcacctcactggccatcctggtcttctacctgccgtcc
gactgcggtgagaagatgacgctgtgcatctccgtgctgctggcgctcaccgttttcctg
ctgctcatctccaagatcgtgccgcccacctccctcgacgtgccgctggtcggcaagtac
ctcatgttcaccatggtgctcgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcccccaccacgcacaccatggcgccctgggtcaaggtcgtcttcctg
gagaagctgccggcgctgctcttcatgcagcagccacgccaccactgcgcccgccagcgc
ctgcgcctgcggcggcgccagcgtgagcgcgagggcgcagaagcctcgttcttcttccgc
gaagtccccggggccgactcatgtacgtgcttcgtcaatcgcgcgtcggtccagggcctg
gccggggccttcggggctgagcccccgcaggtggccggccccgggggcccgtgcggctgc
ggccttcgggaggcggtggacggcgtgcgcttcattgcggaccacatgcggagtgaggac
gaggaccagagtgtgagtgaggactggaagtatgtcgccatggtgattgatcgcctgttc
ctctggatctttgtcttcgtctgtgtctttggcaccatcggcatgttcctgcagcctctc
ttccagaactataccaccaccaccttcctccacccagaccactcggctcccagctccaag
tga

DBGET integrated database retrieval system