KEGG   Loxodonta africana (African savanna elephant): 100655474
Entry
100655474         CDS       T04351                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655474 (GRB2)
   04012 ErbB signaling pathway
    100655474 (GRB2)
   04014 Ras signaling pathway
    100655474 (GRB2)
   04630 JAK-STAT signaling pathway
    100655474 (GRB2)
   04068 FoxO signaling pathway
    100655474 (GRB2)
   04072 Phospholipase D signaling pathway
    100655474 (GRB2)
   04151 PI3K-Akt signaling pathway
    100655474 (GRB2)
   04150 mTOR signaling pathway
    100655474 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100655474 (GRB2)
   04540 Gap junction
    100655474 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100655474 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100655474 (GRB2)
   04660 T cell receptor signaling pathway
    100655474 (GRB2)
   04662 B cell receptor signaling pathway
    100655474 (GRB2)
   04664 Fc epsilon RI signaling pathway
    100655474 (GRB2)
   04062 Chemokine signaling pathway
    100655474 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100655474 (GRB2)
   04912 GnRH signaling pathway
    100655474 (GRB2)
   04915 Estrogen signaling pathway
    100655474 (GRB2)
   04917 Prolactin signaling pathway
    100655474 (GRB2)
   04926 Relaxin signaling pathway
    100655474 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    100655474 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100655474 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100655474 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100655474 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655474 (GRB2)
   05206 MicroRNAs in cancer
    100655474 (GRB2)
   05205 Proteoglycans in cancer
    100655474 (GRB2)
   05203 Viral carcinogenesis
    100655474 (GRB2)
   05231 Choline metabolism in cancer
    100655474 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100655474 (GRB2)
   05225 Hepatocellular carcinoma
    100655474 (GRB2)
   05226 Gastric cancer
    100655474 (GRB2)
   05214 Glioma
    100655474 (GRB2)
   05221 Acute myeloid leukemia
    100655474 (GRB2)
   05220 Chronic myeloid leukemia
    100655474 (GRB2)
   05211 Renal cell carcinoma
    100655474 (GRB2)
   05215 Prostate cancer
    100655474 (GRB2)
   05213 Endometrial cancer
    100655474 (GRB2)
   05224 Breast cancer
    100655474 (GRB2)
   05223 Non-small cell lung cancer
    100655474 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    100655474 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100655474 (GRB2)
   05160 Hepatitis C
    100655474 (GRB2)
   05163 Human cytomegalovirus infection
    100655474 (GRB2)
   05165 Human papillomavirus infection
    100655474 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100655474 (GRB2)
   01522 Endocrine resistance
    100655474 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100655474 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100655474 (GRB2)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100655474 (GRB2)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100655474 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 100655474
NCBI-ProteinID: XP_003417309
UniProt: G3SX55
LinkDB
Position
Unknown
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGSDVQHFKVLRDGAGKYFL
WVVKFSSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGSCHGQTGMFPRNYVTPVNRNV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaagtatgacttcaaagctaccgcggacgacgagctgagcttcaaa
aggggggacatcctcaaggtcttgaatgaagaatgtgatcagaactggtacaaggcagag
cttaatgggaaagacggcttcattcccaagaattacatagaaatgaaaccacacccgtgg
ttttttggcaaaatccccagagcaaaggcagaagaaatgcttagcaaacaacggcatgat
ggggcctttcttatccgagagagtgagagtgctcctggggatttctccctctctgtcaag
ttcggcagtgacgtgcagcacttcaaggtgctccgagacggggccggcaagtatttcctc
tgggtggtgaagttcagttcgctcaatgagctggttgattatcacagatctacatctgtc
tccagaaaccagcagatattcctccgggacatagaacaagtgccgcagcagcccacatac
gtccaggccctctttgactttgacccccaggaggatggagagctggggttccgtcgggga
gactttatccatgtcatggataactcagaccccaactggtggaaaggctcctgccacggg
cagaccggcatgttcccccgcaactacgtcacccctgtgaaccggaatgtctag

DBGET integrated database retrieval system