KEGG   Loxodonta africana (African savanna elephant): 100656140
Entry
100656140         CDS       T04351                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04110  Cell cycle
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100656140 (E2F3)
   04218 Cellular senescence
    100656140 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656140 (E2F3)
   05206 MicroRNAs in cancer
    100656140 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100656140 (E2F3)
   05225 Hepatocellular carcinoma
    100656140 (E2F3)
   05226 Gastric cancer
    100656140 (E2F3)
   05214 Glioma
    100656140 (E2F3)
   05220 Chronic myeloid leukemia
    100656140 (E2F3)
   05218 Melanoma
    100656140 (E2F3)
   05219 Bladder cancer
    100656140 (E2F3)
   05215 Prostate cancer
    100656140 (E2F3)
   05224 Breast cancer
    100656140 (E2F3)
   05222 Small cell lung cancer
    100656140 (E2F3)
   05223 Non-small cell lung cancer
    100656140 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100656140 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656140 (E2F3)
   05161 Hepatitis B
    100656140 (E2F3)
   05160 Hepatitis C
    100656140 (E2F3)
   05163 Human cytomegalovirus infection
    100656140 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656140 (E2F3)
   05169 Epstein-Barr virus infection
    100656140 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100656140 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100656140 (E2F3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100656140 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100656140
NCBI-ProteinID: XP_010594489
LinkDB
Position
Unknown
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDPLESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPTSKDLASTNSGHSDCSVSMANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctgggagaaagcggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactccgaagtccagac
agtccaaaaactccaaaatctccctcagaaaaaacacggtatgatacgtcacttggtctg
ctcaccaagaagttcattcagctactgagccaatcacccgatggggtcttggatttgaac
aaggcagctgaggtgcttaaagtgcaaaagagaaggatttatgacatcaccaacgtcctg
gaaggcatccacctcattaagaagaaatctaaaaacaacgttcagtggatgggctgcagt
ctgtctgaggacggtggcatgctggcccagtgccaaggcctgtcaaaggaagtgaccgag
ctcagtcaggaagagaagaaactagatgaactcatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgtaacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgacccactagagagcctacaaattcatttggcaagtacccaaggaccc
attgaggtttacttatgtccagaagagactgaaacacacagtccaatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagcgattgctccgtttctatggcaaatctttctcctttggcctctcccgccaac
cttttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaactta
ctgcctcctctgctccaagaagactatctactaagcctgggggaggaagaaggcatcagt
gatctctttgatgcttacgatttggaaaagcttccactggtggaagacttcatgtgtagt
tga

KEGG   Loxodonta africana (African savanna elephant): 100664468
Entry
100664468         CDS       T04351                                 

Gene name
E2F1
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04110  Cell cycle
lav04137  Mitophagy - animal
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100664468 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100664468 (E2F1)
   04218 Cellular senescence
    100664468 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664468 (E2F1)
   05206 MicroRNAs in cancer
    100664468 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100664468 (E2F1)
   05225 Hepatocellular carcinoma
    100664468 (E2F1)
   05226 Gastric cancer
    100664468 (E2F1)
   05214 Glioma
    100664468 (E2F1)
   05220 Chronic myeloid leukemia
    100664468 (E2F1)
   05218 Melanoma
    100664468 (E2F1)
   05219 Bladder cancer
    100664468 (E2F1)
   05215 Prostate cancer
    100664468 (E2F1)
   05224 Breast cancer
    100664468 (E2F1)
   05222 Small cell lung cancer
    100664468 (E2F1)
   05223 Non-small cell lung cancer
    100664468 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664468 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100664468 (E2F1)
   05161 Hepatitis B
    100664468 (E2F1)
   05160 Hepatitis C
    100664468 (E2F1)
   05163 Human cytomegalovirus infection
    100664468 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664468 (E2F1)
   05169 Epstein-Barr virus infection
    100664468 (E2F1)
   05165 Human papillomavirus infection
    100664468 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100664468 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100664468 (E2F1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100664468 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100664468
NCBI-ProteinID: XP_003411557
LinkDB
Position
Unknown
AA seq 455 aa
MGSEPTTAACHPEPRGAVNAWPVPGPPAGGPCAPALEALLEADALRLLDSSQIVIISTAQ
DASAPPAPAGPSAPAAGPRDPDLLLFATPQAPRPTPSAPRPSLGRPPVKRRLDLETDHQY
LAETSGPGRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLDLLSRSADGVVDLNWAAEEL
KVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTAVGISGQLEGLTQDLRHLQESERQL
DHLIHVCTTQLRLLSEDADSQRLAYVTCQDLRSIADPAEQMVVVIKAPPETQLQAVDSSE
TFQIYLKSKQGPIDVFLCPEESSGGISPGKTPTQAAASPGEEDRVAVPAITVPPPSPPSS
PATDPGQSLLSLEQEPLLSRMGGLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFIS
LSPPHEALDYHFGLEGEGIRDLFDCDFGDLTPLDF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggttctgagccgacgaccgccgcttgccaccccgagccgcgcggagccgtgaacgca
tggccggtgccggggcccccggcgggcggcccatgcgcgccggcgctggaggccctgctc
gaggcggacgcgctgcggctgcttgactcctcgcagatcgtcatcatctccacggcgcag
gacgccagcgccccgccggcccccgccggcccctccgctcccgccgccggcccccgcgat
cccgacctgctgctcttcgccacgccacaggcgccccggcccacacccagcgccccgcgc
ccctcgctcggccgcccgccggtaaagcggaggctggacctggaaactgaccatcagtac
ctggctgagaccagtgggccaggccggggcaggggccgccacccggggaaaggcgtgaaa
tctccgggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgcttcctg
gacctgctgagccgctcagccgacggtgttgtcgacctgaactgggcagctgaggagctg
aaggttcagaaacggcgcatctacgacatcaccaatgtccttgagggcatccagcttatc
gccaagaagtccaagaaccacatccagtggctgggcagtcacacagcagtggggatcagt
gggcaactcgaaggactgacccaggacctccggcacctgcaggagagcgagcgacagctg
gaccacctgattcacgtctgtaccacacagctgcggttgctctctgaggatgccgacagt
cagcgcctggcttacgtgacctgccaggatctacgtagcatcgcagaccctgcagagcag
atggttgtggtgatcaaggcccctcccgagactcaactccaagccgtggactcctccgag
acctttcagatctaccttaagagcaaacaaggccccattgatgttttcctgtgccctgag
gaaagctcgggtgggatcagccccggaaagaccccaacccaggcagcggcttctcctggg
gaggaggacagggtggctgtccctgccatcacagtaccaccaccatcacctccttcatct
cctgccacagatcctggccagtccctgctcagcctggagcaagaaccgctgctgtcccgg
atgggcggcctgcgggcccctgtggatgaggaccgcctgtccccgctggtggcggccgac
tcgctcctggaacatgtgcgggaggacttctctggcctcctccctgaggagttcatcagc
ctgtctcctccccatgaggccctcgactaccactttggcctcgagggtgagggcatcaga
gacctcttcgactgtgactttggggacctcacccccctggatttctga

KEGG   Loxodonta africana (African savanna elephant): 100665816
Entry
100665816         CDS       T04351                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04110  Cell cycle
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100665816 (E2F2)
   04218 Cellular senescence
    100665816 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665816 (E2F2)
   05206 MicroRNAs in cancer
    100665816 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100665816 (E2F2)
   05225 Hepatocellular carcinoma
    100665816 (E2F2)
   05226 Gastric cancer
    100665816 (E2F2)
   05214 Glioma
    100665816 (E2F2)
   05220 Chronic myeloid leukemia
    100665816 (E2F2)
   05218 Melanoma
    100665816 (E2F2)
   05219 Bladder cancer
    100665816 (E2F2)
   05215 Prostate cancer
    100665816 (E2F2)
   05224 Breast cancer
    100665816 (E2F2)
   05222 Small cell lung cancer
    100665816 (E2F2)
   05223 Non-small cell lung cancer
    100665816 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100665816 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100665816 (E2F2)
   05161 Hepatitis B
    100665816 (E2F2)
   05160 Hepatitis C
    100665816 (E2F2)
   05163 Human cytomegalovirus infection
    100665816 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665816 (E2F2)
   05169 Epstein-Barr virus infection
    100665816 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100665816 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100665816 (E2F2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100665816 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA
Other DBs
NCBI-GeneID: 100665816
NCBI-ProteinID: XP_010593379
LinkDB
Position
Unknown
AA seq 434 aa
MLRGPRALAPAAGPPQKGLPAISPTELWPPGLGSPQLCPATTTYYTSLYQQTVPPTAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVSEFRTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGTLEDPTWPGKQQQLGQELKELITMEQALDQLIQSCSVNFKHLTE
DKTNKRLAYVTYQDLRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEMQEPDSPTKEPLPSTSTLDPSPDSAQPSSGTSPEIVEPEASSVPAMTPQQVLQP
PLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPPLDQDDYLWGLDGGEGIS
DLFESYDLGDLLIN
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgggccctggctccggccgccgggccaccccaaaagggactgccc
gcgataagtcccaccgagctgtggccgcctggactcggcagcccccagctctgcccggcc
accaccacctactacacctcgttgtaccagcagacagtgcctcccaccgcggcaccgggc
acctgcctcgacgcgacccctcacggaccagagggccaagctgtgcgatgcgtgcccgca
ggccggctgccggccaaaaggaagctggacctggaggggatcgggcggcccgcagtttct
gaattccggactcccaaggggaagtgcattcgagtggatggcctccccagccccaaaacc
cccaagtcccccggggagaagacacggtatgacacgtcactggggctgctcaccaagaag
ttcatttacctcctgagcgagtctgaggatggggtcctggacctgaactgggccgcggag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaacacttgaagat
cccacctggcctgggaagcagcagcagctgggacaggagctgaaggagctgataaccatg
gagcaggccttggaccagctcatccagagctgctctgtgaactttaagcacctgactgag
gacaagaccaacaagagactggcctatgtaacttaccaggacctccgggctgtcggcaac
tttaaggaacagacggtaatcgctgtaaaagcccctccgcagacgaggctggaagtgccc
gacaggagcgaggagaatctgcagatatatctgaagagcacccaagggcccattgaagtc
tacctgtgtccggaggagatgcaggagccagacagccctaccaaggagccgcttccctcc
acctccacccttgaccccagccctgactctgcccagcccagcagcggtaccagccctgag
atcgtggaacccgaagcatcctcagtaccagcgatgactccccagcaggtcctgcagccg
ccccttgtccccctggaggccaccgacagcatgttggagctgccacacccacttctgcag
cagactgaggaccagttcctgtccccaacgctggcgtgcagctctccattgatcagcttc
tccccacccttggatcaggatgactacctgtggggcctggacgggggcgagggcatcagt
gacctcttcgagtcctatgaccttggggacctgttgattaattga

DBGET integrated database retrieval system