KEGG   Loxodonta africana (African savanna elephant): 100656157
Entry
100656157         CDS       T04351                                 

Definition
(RefSeq) CHRNA7-FAM7A fusion protein
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05033  Nicotine addiction
lav05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656157
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656157
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100656157
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100656157
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656157
   05022 Pathways of neurodegeneration - multiple diseases
    100656157
  09165 Substance dependence
   05033 Nicotine addiction
    100656157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656157
Ion channels [BR:lav04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100656157
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD SUR7
Other DBs
NCBI-GeneID: 100656157
NCBI-ProteinID: XP_023395423
LinkDB
Position
Unknown
AA seq 321 aa
MQEADISSYIPNGEWDLVGIPGKRSEKFYDCCKEPYPDVTFTVTMRRRTLYYGLNLLIPC
VLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM
IIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQ
RRCSLASVEMNAMAGPPTSNGNLLYLGFRGLDTVHCAPTPDSGVVCGRMACSPTHDGHLL
HGGQPAEGDPDLAKILEEVRYIANRFRCQDESEAICSEWKFAACVVDRLCLMAFSIFTII
CTIGILMSAPNFVEAVSKDFA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaggaggcagacatcagcagctacatcccgaatggagagtgggatcttgtgggaatc
cccgggaagaggagtgagaagttctatgactgctgcaaagagccatacccagatgtcacc
ttcacagtgaccatgaggcgcaggaccctctactatggcctcaacctgctcatcccctgt
gtgctcatctctgccttggccctgttagtgttcctgctgcctgcagactctggcgagaaa
atctccctggggataacggttttactttctctgactgtcttcatgctgcttgtggctgag
atcatgcctgcgacgtccgattcagtgccattgattgcccagtattttgccagcaccatg
atcattgtcggcctctctgttgttgtgacggtgatcgtgctgcagtaccaccaccacgac
cctgatgggggcaagatgcccaagtggaccagagtcatcctcctgaactggtgtgcctgg
ttcctgcgcatgaaaaggccaggggaggacaaggtgcgtcccgcctgccagcacaagcag
cgccgctgcagcctggccagtgtggagatgaatgccatggctgggccacccaccagcaat
gggaacctactctaccttggcttccgtggcctggacaccgtgcactgtgccccaacacct
gactctggggtcgtgtgtggccgcatggcctgctcgcccacacatgatgggcacctccta
catggtgggcagcctgcagagggcgacccggacctggccaagatcctggaggaggtccgc
tacatcgccaaccgcttccggtgccaggatgagagtgaggccatctgcagcgaatggaag
tttgcagcctgcgtggtcgaccgtctttgcctcatggccttctccatcttcaccatcatc
tgcaccatcggcatcctgatgtcggctcccaacttcgtcgaggccgtgtccaaagatttt
gcttag

DBGET integrated database retrieval system