KEGG   Loxodonta africana (African savanna elephant): 100656243
Entry
100656243         CDS       T04351                                 

Gene name
CHRM5
Definition
(RefSeq) muscarinic acetylcholine receptor M5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav04810  Regulation of actin cytoskeleton
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656243 (CHRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656243 (CHRM5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100656243 (CHRM5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100656243 (CHRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656243 (CHRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    100656243 (CHRM5)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100656243 (CHRM5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 100656243
NCBI-ProteinID: XP_003418683
UniProt: G3TYL0
LinkDB
Position
Unknown
AA seq 532 aa
MEGESYHNATTVNGTPVNHQPLEHHGLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPP
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSVSMAEDE
KRKPSHRDLFRSCFNCPRPTLAQKERNQASWSSSRRSTSTTGKPTQPTGLSTDWAKAEQL
TTCSSYPSSEDEDKPTTDPVFQVVYKSQAKESPKEEFSAEETREAFGKAQTEKNDYDTHK
YFLSPAAAHTPKSQKCVAYKFRLVVKADGTQETNNSCRKVKIMPCSFPVSKDSSPKSLDP
NLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggggaatcttatcacaatgcaaccactgtcaatggcaccccagtcaatcatcag
cccttggaacaccatggattgtgggaagtcatcaccatagcagctgtaacagctgtggta
agcctgatcaccattgtgggcaatgttttagtcatgatctccttcaaagtcaacagtcag
ctcaagacagttaacaactattacttgctcagcttagcttgtgcagatctcatcataggg
atcttctccatgaacctctatacgacttacatcctcatgggacgctgggccctggggagt
ctggcttgtgatctatggcttgcactggactatgtggccagcaatgcttctgtcatgaac
cttctggtgatcagctttgaccgttacttttccatcacaagacccctgacatatcgggcc
aagcgtactccaaagagagctggcattatgattggtttggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggttggggagcggacagtaccacca
gatgagtgccagatccaattcctttctgagcccaccatcacttttggtactgccattgct
gccttctacatccctgtttctgtcatgaccatcctctactgccgaatctaccgggaaaca
gagaagcggaccaaggacctggctgacctccagggctctgtctccatggccgaagatgag
aagagaaagccctctcacagggatctgttcaggtcctgcttcaactgccctcggcccacc
ctggcccaaaaggaaaggaaccaggcctcctggtcatcttcccgaagaagcacttccacc
actggaaagccaacccaacccactggcctaagcactgactgggccaaagctgagcagctt
actacctgtagcagctacccctcctcagaggatgaggacaagcccaccactgaccctgtc
ttccaagtggtttacaagagtcaggccaaggaaagcccaaaggaagaattcagtgctgaa
gagaccagggaagcttttgggaaagctcaaactgaaaaaaatgactatgacacccataaa
tacttcctgtctccagctgctgctcatacacccaagagtcagaaatgtgtggcctataaa
ttcagattggtggtaaaagctgatgggacccaggagaccaacaatagctgtagaaaggtg
aaaatcatgccctgctcctttccagtatccaaggactcttcaccgaaaagccttgacccc
aacctcagccatcaaatgactaaacgaaagagaatggtccttgtcaaagagaggaaagca
gctcagaccttgagtgctattcttctagctttcatcatcacatggaccccttataatatc
atggtcctggtctctaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tactggttgtgctatgtcaacagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtattggcaagggaatagcaagctaccatga

KEGG   Loxodonta africana (African savanna elephant): 100667215
Entry
100667215         CDS       T04351                                 

Gene name
CHRM3
Definition
(RefSeq) muscarinic acetylcholine receptor M3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav04742  Taste transduction
lav04810  Regulation of actin cytoskeleton
lav04911  Insulin secretion
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100667215 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100667215 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100667215 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100667215 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    100667215 (CHRM3)
   04971 Gastric acid secretion
    100667215 (CHRM3)
   04972 Pancreatic secretion
    100667215 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    100667215 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    100667215 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100667215 (CHRM3)
   05022 Pathways of neurodegeneration - multiple diseases
    100667215 (CHRM3)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100667215 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100667215
NCBI-ProteinID: XP_003410960
UniProt: G3U625
LinkDB
Position
Unknown
AA seq 590 aa
MTLHNNSTASPLFPNISSSWIHGPSDTGLPPGTVTHFGSYNISRAAGNFSSPNVTTSDPL
GGHTVWQVVFIAFLTGSLALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSAKRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELVKADLERKASKLQAQKSMEDGGSF
QKSFSKLPIQLESAVDTAKTSDDSSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKAYWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaccttgcacaacaatagtacagcctcgcctttgtttccgaacatcagctcttcctgg
atacatggcccctcggacacaggactgcccccaggaacagtcactcattttggcagctac
aacatttctcgggcagctgggaatttctcctctccaaatgtcaccaccagtgaccctctg
ggaggccacaccgtctggcaagtggtcttcattgcattcttaacgggctccctggccttg
gtgaccatcattggcaacatcctagtcatagtgtcatttaaggtcaacaagcagctgaag
acagtcaataactacttcctcttaagcctggcctgtgcagacctgattattggggtcatt
tcaatgaatctgtttactacctacatcattatgaatcgatgggctttagggaacttggcc
tgtgacctctggctttccattgactatgtggctagcaatgcctcagtcatgaatcttctg
gtcattagctttgacaggtacttttctatcacaaggccactcacgtaccgagccaaacga
accacaaaaagagccggtgtgatgatcggtttggcttgggtcatctcttttatcctttgg
gctcccgccatcttgttctggcaatactttgttggaaagaggactgtgcccccaggggag
tgtttcattcagttcctcagtgagcccaccattacctttggcacggccattgctgccttt
tatatgcctgtcaccattatgactattttatattggaggatctataaggaaactgaaaaa
cgtaccaaagagcttgctgggctgcaagcctctgggacagaagcagagacagaaaacttt
gtccaccccacaggcagctctcgaagctgcagcagctatgagcttcaacagcaaagcatg
aaacgctcagccaagaggaagtacggccgctgccacttctggttcacaaccaagagctgg
aagcccagtgctgaacagatggaccaagaccacagcagcagtgacagctggaacaacaat
gacgctgctgcctccctggaaaactccgcctcttccgatgaggaggacattggctccgag
acaagagccatctactctattgtgctcaagcttccaggtcacagcaccatcctcaactcc
accaaattaccctcatcagacaacctgcaggtgcctgaggaggagctggtgaaggcagac
ttggagaggaaagccagcaagctgcaggcccagaagagcatggaggatggaggcagtttc
cagaaaagcttctctaagcttcccatccagttagagtcagccgtggacacagccaagacc
tctgatgacagctcctcagtgggaaagaccacggccactctacctctgtccttcaaagaa
gcgactctggccaagaggttcgctctgaagaccaggagtcagatcactaaacggaaaaga
atgtccctcatcaaggagaagaaggcagcccagaccctcagtgcgatcttacttgccttc
atcatcacctggaccccgtacaacatcatggttctggtgaacaccttctgtgacagctgc
atccccaaagcctattggaacctaggctactggctgtgctacatcaacagcaccgtgaac
ccggtgtgctacgcactgtgcaacaagacattcagaaccacgttcaagatgctgctgctg
tgccaatgtgacaagaggaagaggcgcaagcagcagtaccagcaaagacagtccgtcatt
ttccacaagcgtgtgcccgagcaggccttgtag

KEGG   Loxodonta africana (African savanna elephant): 100674374
Entry
100674374         CDS       T04351                                 

Gene name
CHRM1
Definition
(RefSeq) LOW QUALITY PROTEIN: muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04725  Cholinergic synapse
lav04810  Regulation of actin cytoskeleton
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100674374 (CHRM1)
   04024 cAMP signaling pathway
    100674374 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100674374 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674374 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674374 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100674374 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674374 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100674374 (CHRM1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100674374 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100674374
NCBI-ProteinID: XP_010597404
LinkDB
Position
Unknown
AA seq 462 aa
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYPPGSRFMCTLYWRIYRGDREPEHRELAALQGSETPGKGGGSS
SSSERSQPGAEGSPETLPGRCCRCCRTPRLLQAYSWKEEEEEDEGSMESLTSSEGEETGS
EVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKGPKPRGKEQLAKRKTFSLV
KEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCY
ALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaacacctcagccccgcccgccgtcagccccaacatcactgtcctggcaccgggaaag
ggtccatggcaagtggccttcattgggatcaccactggcctcctgtcactggccacggtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacggtcaac
aactacttcctgctgagcctggcctgtgccgacctcatcatcggcaccttctccatgaac
ctctacaccacctacctgctcatgggccactgggctctgggcacgctagcctgcgacctc
tggctggccctggactatgtggccagcaatgcctctgtcatgaacctgctgcttatcagc
tttgaccgatacttctccgtgacgcggcccctgagctaccgtgcaaagcgcacgccccgc
cgggcggccctcatgatcggcctggcctggctggtttccttcgtcctctgggccccagcc
atcctcttctggcagtacctggtgggtgagcggacagtgctggccgggcagtgctacatc
cagtttctctcccagcccatcatcaccttcggcacagccatggctgccttctaccctccc
gggtcacggttcatgtgcacgctctactggcgcatctaccggggagaccgagaacccgag
caccgggagctggcagccctgcaaggctcggagacaccaggcaagggaggcggcagcagc
agcagctcagagcggtcccagccaggggcagagggctcccctgagaccctcccagggcgc
tgctgccgctgctgccggaccccccggctgctgcaggcctacagctggaaggaggaagag
gaggaggacgaaggctccatggagtccctcacgtcctccgagggtgaggagaccggctcc
gaggtggtgatcaagatgcccatggtggaccctgaggcacaggcccccgccaagcagccc
ccccggagctccccaaatacagtcaagaggcccacccggaaggggcgggagcgagctggc
aagggcccaaagccccgtgggaaggagcagctggccaagcggaagaccttctcactggtc
aaggagaagaaggcggctcggaccctgagtgccatcctgttggccttcatcctcacctgg
acaccatacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcctgagacc
ctgtgggagctgggttactggctgtgctacgtcaacagcaccatcaaccccatgtgctat
gcactctgcaacaaagccttccgggacaccttccgcctgctgctgctctgccgctgggac
aaacgtcgctggcgcaagatccccaagcgccctggttctgtgcaccgcaccccctcccgc
caatgctga

DBGET integrated database retrieval system