KEGG   Loxodonta africana (African savanna elephant): 100657987
Entry
100657987         CDS       T04351                                 

Gene name
PNPLA2
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 2
  KO
K16816  patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00561  Glycerolipid metabolism
lav01100  Metabolic pathways
lav04714  Thermogenesis
lav04923  Regulation of lipolysis in adipocytes
Module
lav_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100657987 (PNPLA2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100657987 (PNPLA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100657987 (PNPLA2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     100657987 (PNPLA2)
SSDB
Motif
Pfam: Patatin TetR_N
Other DBs
NCBI-GeneID: 100657987
NCBI-ProteinID: XP_023398118
LinkDB
Position
Unknown
AA seq 521 aa
MGMFMGRSLGVWRGLCVGRACGLRVGAAEAWGPWGVVGGPDRRGGHRASTPNPRLGKPVA
QPPTTEKGRAGGGWREPGAVIAAQGLATAGGFGGDTTWNISFAGCGFLGIYHIGVASCLR
EHAPFLVANATHIYGASAGALTATALVTGVCLGEASASMIEVSKEARKRFLGPLHPSFNL
VKIIRGRLLKVLPDNSHERASGRLGISLTRVSDGENVIIYHFSSKEELIQANVCSTFIPV
YCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNT
SIQFNLRNLYRLSKALFPPDPVVLREMCKQGYRDGLRFLRRNGAWAGCVEPKDPYDHFSN
MLPVRLAMAMMVPYTLPLESAVSFTIRLLEWLPDVPEDIRWMREQTASICQYLMMRAKRK
LGGHLSARLSEQVELRRTQSLPSVPVSCATYSKALPVWMRNNLSLGDALAKWEECQRQLL
LGLFCSNVAFPPDALRMRPPAGPAPAPAPAPSQPPPDLPRC
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggggatgtttatgggtcggagtctgggtgtgtggcgggggctctgtgtcgggagagcc
tgtggtctgcgcgtgggtgcggccgaggcgtgggggccctggggggttgtaggaggacct
gaccggagaggcggccaccgcgcgagcactcccaaccccaggctcgggaagccggtcgcc
cagccgcccacgacggagaagggaagggccggtgggggctggcgagagccgggcgcggtc
atcgcagctcaggggctggcgaccgcgggcggtttcggaggggacacgacgtggaacatc
tcgttcgcgggctgcggcttcctcggcatctaccacatcggcgtggcctcctgcctccgc
gagcacgcgcccttcctggtggccaacgccacgcacatctatggcgcctcggccggggcg
ctcacggccacggcgctcgttaccggggtctgcctgggtgaggctagtgccagtatgatt
gaggtgtctaaggaggccaggaagcggttcctgggcccactgcacccctccttcaatctg
gtgaagatcatccgtggccgcctgctgaaggtactgcctgacaacagccatgaacgggcc
agcgggcgcctgggtatctccctgacccgtgtctcggacggcgagaatgtcatcatatac
cacttcagctccaaggaggagctcatccaggccaatgtctgcagcaccttcattcccgtg
tactgcggcctcatccccccctccctgcagggcgtgcggtatgtggatggcggcatctca
gacaacctgccactttatgagctcaagaacactatcaccgtgtcccccttctcgggtgag
agcgacatctgcccgcaggacagctccaccaacatccacgagctgcgggtcaccaacact
agcatccaattcaacctgcgcaacctctaccgtctctccaaggccctcttccccccggac
cctgtggtgctgcgcgagatgtgcaagcagggctacagagacggactgcgcttcctgcgg
cggaatggtgcgtgggcaggctgcgtggagcccaaggacccttatgaccacttctccaac
atgctgcccgtgcgcctggccatggccatgatggtgccctacacgctgccgctggagagc
gccgtgtcattcaccatccgcttgctggagtggctgccagacgtccccgaggacatccgg
tggatgagggagcagacggcgagtatctgccagtacctgatgatgcgcgccaagaggaag
ctgggcggccacctgtccgcccggctctccgagcaggtggagttgcgccgcacccagtcc
ctgccctccgtgccggtgtcctgcgccacctacagcaaggcgctacccgtttggatgcgc
aacaacctctcgcttggggacgcgctggccaagtgggaggagtgccagcgccagctgctg
cttggtcttttctgctccaacgtggccttcccgcccgacgccctgcgcatgcgcccgccc
gccggccccgcgcccgcccccgcccccgccccctcgcagcccccgcccgacttaccccgg
tgctga

DBGET integrated database retrieval system