KEGG   Loxodonta africana (African savanna elephant): 100658146
Entry
100658146         CDS       T04351                                 

Gene name
ACTC1
Definition
(RefSeq) actin, alpha cardiac muscle 1
  KO
K12314  actin, alpha cardiac muscle
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100658146 (ACTC1)
   04261 Adrenergic signaling in cardiomyocytes
    100658146 (ACTC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100658146 (ACTC1)
   05414 Dilated cardiomyopathy
    100658146 (ACTC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100658146 (ACTC1)
   04147 Exosome [BR:lav04147]
    100658146 (ACTC1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100658146 (ACTC1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100658146 (ACTC1)
  Exosomal proteins of bladder cancer cells
   100658146 (ACTC1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100658146
NCBI-ProteinID: XP_003418690
UniProt: G3TQN7
LinkDB
Position
Unknown
AA seq 377 aa
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgcgacgacgaagagaccaccgccctggtgtgcgacaacggctccgggctggtgaag
gccggcttcgcgggcgatgacgcgccccgcgcggtcttcccctctatcgtgggccgcccg
cgccaccagggagttatggtgggcatgggtcagaaggattcgtatgtaggcgatgaggcc
cagagcaagagaggtatcctgactctcaagtaccccattgagcacggtatcatcaccaac
tgggacgacatggagaagatctggcaccacaccttctacaacgagctccgcgtggcccct
gaggagcaccccaccctactcactgaggccccgctcaaccccaaggccaaccgtgagaag
atgacccaaatcatgtttgagaccttcaatgtccctgccatgtatgtggccatccaggcg
gtgctgtccctgtatgcttctggccgtactacaggcattgttctggactctggggatggt
gtaacccacaatgtccccatctatgagggctatgctttgccccatgccatcatgcgtctg
gatctagctggtcgggacctcactgactatctcatgaagatcctcaccgagcgtggctat
tcctttgtcaccaccgctgaacgagaaattgtccgcgacattaaagagaagctgtgctat
gtcgccctggattttgagaatgagatggccacagctgcctcttcctcctctctggagaag
agctatgaactgcctgatggccaagtcatcactattggcaacgaacgcttccgctgccca
gagacactcttccagccctccttcatcggtatggaatctgctggcatccatgaaactact
tacaatagcatcatgaagtgtgacatcgatattcgcaaggacctgtatgccaacaacgtc
ttgtctggaggcaccaccatgtaccctggtattgctgaccgtatgcaaaaagaaatcact
gccctggctcccagtactatgaagattaagattattgctcctcctgagcgtaagtactct
gtttggatcgggggctccatccttgcctccctctccaccttccagcagatgtggattagc
aagcaagaatatgatgaggcaggcccatccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system