KEGG   Loxodonta africana (African savanna elephant): 100658513
Entry
100658513         CDS       T04351                                 

Gene name
CHEK1
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav05166  Human T-cell leukemia virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100658513 (CHEK1)
   04115 p53 signaling pathway
    100658513 (CHEK1)
   04218 Cellular senescence
    100658513 (CHEK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100658513 (CHEK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100658513 (CHEK1)
   05170 Human immunodeficiency virus 1 infection
    100658513 (CHEK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100658513 (CHEK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100658513 (CHEK1)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100658513 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 100658513
NCBI-ProteinID: XP_010595448
LinkDB
Position
Unknown
AA seq 475 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKIVDMKRAIDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSVRITIPDIKKDRWYNKPLKKGTRRPQVTSGGVSESPSGFSKHIQSNLDF
SPLNSASSETIKPSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLG
TPGSSQNPWQRLVKRMTRFFTKLDADKSYHCLKETCEKLGYQWKKSCMNQVTVSTTDRRN
NKLIFKVNLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKVWLPAT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagaagaactgaagaagcagttgcagtgaagattgtg
gacatgaagcgtgccatagactgtccagaaaatattaagaaagaaatctgtatcaataaa
atgttaaaccatgagaatgtagtgaaattctatggccataggagagaaggcaatatccag
tatctgtttctggagtactgtagtgggggagaactttttgatagaatagagccagacata
ggcatgcctgaacaagatgctcagaggttcttccatcaactaatggcaggggtggtttat
ctgcatggtattggaataacccatagggatattaagccagaaaatctcctattggatgaa
agagataacctcaaaatctctgactttggcttggcaacagtgtttcggcataataatcgt
gagcgtttactgaacaagatgtgtggtactttaccttatgttgctccagaacttctaaag
agaaaagaatttcacgcagaaccagttgatgtttggtcctgtggaatagttcttacggca
atgttggctggagaattgccgtgggaccagcctagtgacagttgtcaggaatattctgat
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaattgattctgctcctctagct
ctgctgcataaaatcctagttgagaatccatcagtaaggattaccatcccagacatcaaa
aaagacagatggtacaataaaccactcaagaaagggacaaggaggccccaggtcacttca
ggaggggtatcagaatctccaagtggattctctaagcacattcaatccaatttggatttc
tctccattaaatagtgcttcaagtgagaccataaagccgtccagctcccagccagaacca
cggacaggcctttcactgtgggacaccagtccctcatacattgataaactggtacaaggg
atcagtttttcccagcctacgtgtcctgatcacatgcttctgaatagtcagttacttggc
actccaggatcctcgcagaacccttggcagcgcttggtcaaaagaatgacacgatttttt
accaaactggatgcagacaaatcttatcactgcctgaaagagacttgtgagaagttgggc
tatcagtggaagaagagttgtatgaatcaggttactgtgtcaacaactgataggagaaat
aataaactaattttcaaagtgaacttggtggaaatggatgagaagatattggtagacttc
agactttctaagggtgatggactggagttcaagagacactttctgaagattaaagggaag
ctgagtgatgttgtgagcagccagaaggtttggcttcctgccacatga

DBGET integrated database retrieval system