KEGG   Loxodonta africana (African savanna elephant): 100659450
Entry
100659450         CDS       T04351                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04670  Leukocyte transendothelial migration
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05219  Bladder cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100659450 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100659450 (MMP2)
   04915 Estrogen signaling pathway
    100659450 (MMP2)
   04926 Relaxin signaling pathway
    100659450 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659450 (MMP2)
   05205 Proteoglycans in cancer
    100659450 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    100659450 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100659450 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100659450 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100659450 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100659450 (MMP2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     100659450 (MMP2)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100659450 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_5 Reprolysin_3 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 100659450
NCBI-ProteinID: XP_003416360
LinkDB
Position
Unknown
AA seq 661 aa
MMENLGARGALAGALRTLCVLGCLLGHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
GGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYNSCTTEGRTDGYRWCGTTDDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNK
HESCTSTGRNDGKMWCATTGNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGA
LMAPIYTYTKNFRLSQDDIKGIQELYGGSPDAGTGTGPTPTLGPVTPEICKQDITFDGVA
QIRGEIFFFKDRFMWRTVTRRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKTVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAVPDNLDAVVDLQGGGHSYFFKEAYYLKLENQSLKVVKFGSIKSDWLG
C
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgatggagaacctaggggcccgaggcgcgcttgccggtgccctgcggacgctctgtgtc
ctaggctgcctgttgggccacgccgccgccgcgccgtcgcccatcatcaagttccccggt
gacgtcgcccccaaaacggacaaagagttggctgtgcaatacctgaacaccttctatggc
tgtcccaaagagagctgcaacctgtttgtgctgaaggacacgctgaagaagatgcagaag
ttctttggactgccccagacaggcgaacttgaccagagcaccattgagaccatgaggaaa
ccacgctgtggcaaccccgatgtagccaactacaacttcttcccccgcaagcccaagtgg
gacaaaaaccagatcacatacaggatcattggctacacacctgatctggaccctgagaca
gtggacgatgccttcgcccgagccttccaagtctggagtgacgtgaccccattgcggttt
tctcgcattcacgatggagaggctgacatcatgatcaactttggccgctgggagcatggc
gatgggtacccatttgacggcaaggacggactcctggcacacgccttcgccccaggccct
ggagttgggggagattcccactttgacgacgatgagctgtggaccctgggagaagggcag
gtggtccgtgtgaagtacgggaacgccgatggagaatactgcaagttcccattcctgttt
ggtggcaaggagtacaccagctgcactgacacgggccgcagtgacggcttcctctggtgt
tccaccacctacaacttcgacaaggacggcaagtacggcttctgtccccacgaagccctg
ttcaccatgggtggcaatgctgacggacagccctgcaagttcccgttccgcttccagggc
acgtcctacaacagctgcaccaccgagggccgcacggatggctaccgctggtgtggtacc
accgacgactacgaccgcgacaagaagtatggcttctgcccagagactgccatgtcaact
gtcggcgggaactcagaaggtgccccatgtgtcttccccttcaccttcctgggcaacaag
cacgagagctgcaccagcaccggacgcaatgacgggaagatgtggtgcgcaaccacgggc
aactacgatgatgaccgcaagtggggcttctgccccgaccaagggtacagcctgttcctc
gtggcagcccacgagtttggccatgcgatggggctggagcactcggaggaccctggagcc
ctgatggcgcccatttacacctacaccaagaacttccgcctgtcccaagatgacatcaag
ggcattcaagagctctatgggggctcccctgacgctggcactggcaccggccccaccccc
acgctgggacccgtcactcccgagatctgcaaacaggacattacctttgatggcgtcgct
cagatccgtggggaaatcttcttcttcaaggaccggttcatgtggcggacagtgacacgg
cgtgacaaacccatgggacccctgttggtggctacgttctggcctgagctcccggagaag
attgacgctgtgtacgaggccccgcaagaggagaagactgtgttttttgcagggaatgag
tactgggtctattcagccagcaccctggagcgcgggtaccccaagcctctgaccagcctg
gggctgccccctgacgtccaacaagtagatgctgcctttaactggagcaagaataagaag
acatacatctttgctggggacaagttctggaggtacaatgaagtgaagaagaaaatggat
cctggcttccccaagctcatcgcagatgcctggaacgctgtccctgataatctggacgcc
gttgtggacctgcagggtggtggtcacagctacttcttcaaggaagcatattacctgaag
ctggaaaaccaaagtttgaaggttgtcaagtttggaagcatcaaatcggactggctgggc
tgctga

DBGET integrated database retrieval system