KEGG   Loxodonta africana (African savanna elephant): 100661613
Entry
100661613         CDS       T04351                                 

Gene name
DDX58
Definition
(RefSeq) probable ATP-dependent RNA helicase DDX58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100661613 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100661613 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    100661613 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100661613 (DDX58)
   05160 Hepatitis C
    100661613 (DDX58)
   05171 Coronavirus disease - COVID-19
    100661613 (DDX58)
   05164 Influenza A
    100661613 (DDX58)
   05162 Measles
    100661613 (DDX58)
   05168 Herpes simplex virus 1 infection
    100661613 (DDX58)
   05169 Epstein-Barr virus infection
    100661613 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:lav04054]
    100661613 (DDX58)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100661613 (DDX58)
Pattern recognition receptors [BR:lav04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100661613 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C DEAD ResIII AAA_22
Other DBs
NCBI-GeneID: 100661613
NCBI-ProteinID: XP_010586184
LinkDB
Position
Unknown
AA seq 931 aa
MTAEERRNLRTFGDYVRKTLDPTYILGYMTPWLREDEMQYIQAEKNNKGTVEAASAFFNF
LVELKEEGWFRGFLDALQRAGYTGLYEAFESWDFQKIEKLEEHRLLLRRLQPEFKTSINP
LDILPEISQCLINQECEEIRQVCFNKGSMAGAEKMVECLVRSDKENWPKALKLALEKEEC
NFNELWIVEKGAEDVEIKDLGDGEMETSEVQIFYQEEPEYQNLSQSSCPPSEVSHTNLYS
PLKPRNYQLELALPAQNGKNTIICAPTGCGKTFVSILICEHHLKKFPQGQKGKIVFFAVQ
IPVYEQQKSVFSKYFERLGYTVAGISGATSEEVPVRQIVENNDIIVLTPQILVNNLKDGI
IPSLSVFTLMIFDECHNTSKHHPYNMIMFNYLDQKLGGSSDPLPQVIGLTASVGVGDAKD
ITDAKMYICKLCAALDTSVIATVKDNLKELEEIVNKPQKFFRKVETRTTNKFKCIISQLM
VEIEKMAESVFEELGTLTLESLSHIQNREYGTQKYEQWIIAVQKACMVFQMPDKNEESRI
CKALFLYTSHLRKYNDALMINEDARIKDALDFLKDFFTNVRAAGFDEIEQDLTQRFEEKL
QELEYVSMDPNNENPKLQDLSFILQEEYHVNPDSRTILFVKTRALVDALKKWIEENPKLS
FLKPGILTGRGRTNQKIGMTLPAQKCVLDTFRSNSDSKILIATSVADEGIDIAQCNLVIL
YEYVGNVIKMIQTRGRGRARGSKCFLVTSKADVIEKEKINIYKEKLMNDSILSLQELDEA
EFKKKLLIIQNQEKFIRDNEGKAKPEPDKKNKKLLCRKCKAFACYTVDIRVVEESHYTVV
GDAFRECFVSKPHPKPRTYGSFEKKAKIHCARQGCSHDWGIYVKYRTFEIPVIKIESFVV
EDIATGAQSLYAKWKDFHFEKIPFDAAEMSK
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgacggccgaggagcgcaggaatctgcgcaccttcggagactacgtcaggaaaaccctg
gaccctacctacatcctgggttatatgaccccctggttgagggaagatgagatgcaatat
attcaggctgagaaaaacaacaagggcactgtggaggctgcctcagcttttttcaacttc
cttgtggagctcaaggaggaaggctggttccgtggctttttggatgccctgcaacgtgca
ggttatactggactttatgaagcctttgaaagctgggatttccaaaaaattgaaaaattg
gaggagcatagattgcttttaagacgtttacaaccagaattcaaaaccagtattaatcca
ttagatattcttcctgaaatatcccagtgtttaattaatcaggaatgtgaagaaattaga
caggtttgtttcaacaaggggtcgatggcaggtgcggagaaaatggttgaatgcctcgtc
agatcagacaaggagaactggcccaaagctttgaaacttgctttggagaaagaagagtgc
aacttcaatgaactgtggattgtagagaaaggtgcagaagatgttgaaattaaagatctt
ggggatggtgaaatggaaacttctgaagtacaaatattctaccaggaagaaccagaatac
cagaatcttagtcagagttcatgtccaccttcagaagtgtctcatactaacttgtacagc
cccttgaagccaagaaattaccaattagagctcgctttgcctgctcagaatggaaaaaat
acaatcatatgtgctcctactggttgtggaaaaacctttgtttccattcttatatgtgaa
catcatcttaaaaaatttccacaaggacaaaaagggaagattgtcttttttgcagttcaa
atcccagtatatgaacagcagaaatccgtgttctcaaaatattttgaaaggcttgggtac
acagtcgcaggcatttctggagcaacatctgaagaggtcccagtgagacagattgttgag
aacaatgacatcatcgttttaactccacagattcttgtgaacaaccttaaagatgggatt
attccatcactctctgtctttactttgatgatattcgatgaatgccacaacaccagtaaa
caccacccatacaatatgatcatgtttaattatctagatcagaagcttggaggatcttca
gacccactgccccaggtcatcgggctaactgcttcagttggcgtcggggatgccaaagac
ataactgatgccaagatgtatatctgcaagctgtgtgctgctcttgacacatcagtgata
gcaacagtcaaagacaacttgaaggaactggaggaaattgttaataagccccagaagttt
ttcaggaaagtggaaacacggactaccaacaaatttaaatgcattatatctcaactgatg
gtggagatagagaagatggcagagagtgtgtttgaagaacttggtactctaactctcgaa
agcttatctcatattcaaaatagggaatacggtacacagaaatacgaacaatggattatt
gcagttcagaaagcgtgcatggtgtttcagatgccggacaaaaatgaagagagcaggatt
tgtaaggcattgttcttgtacacttcgcatctacggaaatataatgatgccctcatgatc
aatgaggatgcccgaatcaaagatgctttggatttcctgaaagacttcttcactaatgtc
cgagcagcaggatttgatgagatagagcaagatctcactcagaggtttgaagaaaagctt
caggaactagagtatgtttccatggatcccaacaatgagaaccctaaactccaagacctt
tccttcatcttgcaagaggagtaccatgtaaacccagattcaagaaccattctgtttgta
aaaaccagagcacttgtggatgctttaaagaaatggattgaagaaaatcctaaactcagc
tttctcaaacctggcatattgactggacgtggtagaacaaatcagaaaataggtatgacc
ctgccagcacagaagtgtgttttggacacattcagatccaacagtgatagcaagattctg
attgccacctcggttgcagatgaaggcattgacattgctcagtgcaatctggtcatcctg
tatgagtatgtgggcaatgtcatcaaaatgattcaaaccagaggtagaggaagagcaaga
ggtagcaagtgcttccttgtgactagtaaagctgatgtaattgaaaaagaaaaaataaac
atatacaaagaaaaattgatgaatgactccattttaagccttcaggaattggatgaagca
gaatttaaaaaaaagcttctcattatacagaatcaagaaaaattcatcagagataatgaa
ggaaaagcaaaacctgaacctgataagaaaaataaaaaactgctctgcagaaagtgcaaa
gcttttgcatgttatacagttgatataagagtggttgaggaatcccattacactgtggtt
ggagatgcttttagggagtgctttgtgagtaagccacatcccaaaccaaggacgtatggg
agttttgagaagaaagcaaagatacactgtgcccgccagggctgcagccatgactgggga
atctatgtgaagtataggacatttgagattccagttataaagattgaaagttttgtggtg
gaggatattgccactggagctcagagcctgtatgcaaagtggaaggactttcattttgag
aagataccatttgatgctgcagaaatgtccaaataa

DBGET integrated database retrieval system