KEGG   Loxodonta africana (African savanna elephant): 100662275
Entry
100662275         CDS       T04351                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X2
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03460  Fanconi anemia pathway
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100662275 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662275 (POLK)
   05202 Transcriptional misregulation in cancer
    100662275 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100662275 (POLK)
   05212 Pancreatic cancer
    100662275 (POLK)
   05225 Hepatocellular carcinoma
    100662275 (POLK)
   05226 Gastric cancer
    100662275 (POLK)
   05214 Glioma
    100662275 (POLK)
   05216 Thyroid cancer
    100662275 (POLK)
   05220 Chronic myeloid leukemia
    100662275 (POLK)
   05217 Basal cell carcinoma
    100662275 (POLK)
   05218 Melanoma
    100662275 (POLK)
   05213 Endometrial cancer
    100662275 (POLK)
   05224 Breast cancer
    100662275 (POLK)
   05222 Small cell lung cancer
    100662275 (POLK)
   05223 Non-small cell lung cancer
    100662275 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100662275 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100662275 (POLK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100662275 (POLK)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100662275 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone Methyltransf_34
Other DBs
NCBI-GeneID: 100662275
NCBI-ProteinID: XP_003408150
LinkDB
Position
Unknown
AA seq 864 aa
MDNTKEKNDDYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIKNMMQQKAQITSQQLRKAQLQVDRFAMDLEQSRDLNSTIVHIDMDAFYAAVEMRDN
PELKNKPIAVGSMSMLTTSNYHARKFGVRAAMPGFIAKRLCPQLIIVPPNFDKYQAVSKE
VKEILADYDPNFMAMSLDEAYLNITEHLQERQNWPEDKRRYFIKTRNSIENDKPREEVGK
LSERELSISPLLFEDSPPDLQPPGISFQVNFEEHNNPQILQNSVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQIHPNRQAVMDFIKDLPIRKISGIGQV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHVSLGLGSTHLERDGERKSMSVER
TFSEISKAEEQYSLCQELCSELAQDLQKKGLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLRTEVDADFPHPLRLRLMGVRISSFANEEDKKHQQRSIIGFLQARNQAL
AATECILEKTDEDQFTKPLKMSHESFFDKKRSEMKWNHQDTFKCETVSKPSLHTSQPFQV
LKKKMDENLETSKNSDNCQIFTCPVCFRAQESISLEVFNRHVDACLGGPSVSEDHAFSSE
VNREENAHHSLSVFEKQDSEAHQKNTEVTSVDCADLIETVGNLSKAESIDALSNKHSKEE
CHSLPSKSFNTECFHQSSSYTVSLENEDGISLSRQESSQPSSHGMITDQALVCPVCNLDQ
KTSDLSLFNMHVDVCLNKGIIQELRKDKVNPVNQPKQCSTSTGSAGRAQKTVTRTRRPGL
ITKHSRSKKTKPDNSRHTLDLFFK
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggataacacaaaggagaagaatgatgattacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggactagataaagaaaaaattaacaaaattata
atggaagctacaaaggggtccagattttatggaaatgagctcaagaaggaaaaacaggtc
aaccaacgaattaaaaatatgatgcaacaaaaagctcagataaccagtcagcagctaagg
aaagcacaattacaggttgacagatttgcaatggatttagagcagagccgggatctgaac
agtaccatagtgcatattgacatggatgctttctatgctgctgtagaaatgagggacaat
ccagaactgaagaataaacccatcgctgtaggatcaatgagtatgttgactacttcaaat
taccatgcaaggaagtttggtgttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattatagtgcctccaaactttgacaaataccaagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacagagcacttacaggaaagacaaaattggcctgaggacaaaagaaga
tatttcatcaaaacaagaaactctatagaaaatgataaaccaagagaggaagttggtaaa
ttgagtgaacgtgaactgtccatctctccactactttttgaagatagtcctcctgatctg
cagcctccaggaatttctttccaagtgaactttgaagaacataacaaccctcaaatactc
caaaactcagttgtttttggaacatcagctgaggaagtggtaaaggaaattcgtttcaga
attgagcaaaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaatatcaaattcaccccaacagacaa
gctgtgatggatttcatcaaggacttacccattagaaagatttctggaattggacaagtt
acagagaaaatgttaaaggcccttggaattattacttgcacagaactctaccaacaaagg
gcattactttctctccttttctctgaaacatcttggcattatttccttcatgtctctctg
gggctaggctcaacacacctggaaagggatggagagaggaaaagtatgagcgttgagagg
acattcagtgagataagtaaagcagaagaacagtacagcttgtgccaagagctttgcagt
gaacttgctcaagatcttcagaaaaaaggacttaagggtagaactgttaccattaagctg
aagaacgtgaattttgaagtcaaaacccgtgcctctacggtttcatctgttgtttctact
gctgaagaaatatttgccattgctaaggaattgctaagaacggaagttgatgctgatttt
ccacatcctttgagattaagacttatgggtgtgcggatatctagttttgccaatgaagaa
gacaagaaacaccaacaaaggagcattattggcttcttacaggctagaaaccaagccctg
gcagccactgagtgtatactagagaaaactgacgaagatcagtttacaaaacctttaaaa
atgtctcatgagagtttcttcgataaaaaaagatcagaaatgaaatggaaccaccaagac
acgtttaaatgtgaaactgtgagtaaaccaagtttacacacatcacaaccgtttcaagtt
ttaaagaagaagatggatgagaatttagaaacatcaaagaattcagataactgtcagata
tttacctgtcctgtttgctttagggcgcaagaaagcatcagcctggaagtctttaataga
catgtggatgcatgtcttggtggaccttcagtcagtgaagaccatgctttctcttcagaa
gttaacagggaagaaaacgcacatcattctctttcagtctttgagaagcaggattctgaa
gcccatcagaagaatacagaggtcacttcagtagactgtgcagatttgatagagactgta
gggaacctatctaaagcagaaagtatagatgctttaagtaataagcacagcaaagaggaa
tgtcatagccttccaagcaagtcttttaatactgaatgctttcatcagagctcttcttat
actgtttcactggaaaatgaagatggcatatcattaagtaggcaagaatcctcccagcca
tcttcacatggaatgataaccgaccaagctctagtttgtcctgtttgtaacctagaccaa
aagacttcagatctttccctattcaatatgcatgtggatgtttgcttaaataaaggtatt
atccaggaactgaggaaggataaagttaatccagttaaccaacccaaacaatgctcaaca
agtactggtagcgcaggcagagcacagaagactgtaacaagaacaagaaggccaggactg
ataacaaagcattcaagatcaaagaaaacaaagccagacaattccagacacaccctcgat
ctattttttaaatga

DBGET integrated database retrieval system