KEGG   Loxodonta africana (African savanna elephant): 100662423Help
Entry
100662423         CDS       T04351                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00604  Glycosphingolipid biosynthesis - ganglio series
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100662423 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lav01003]
    100662423 (B3GALT4)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100662423 (B3GALT4)
Glycosyltransferases [BR:lav01003]
 Glycan extension
  Glycolipid
   100662423 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 100662423
NCBI-ProteinID: XP_003421091
UniProt: G3ULI7
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MSLRLLRRLLLLAALLLVIVWTLFGPSGLGEELLSLWLSSLLPAPASPALPLALPRLLIP
NLEACSGPGTPPFLLILVCTAPENLHQRNAIRASWGGLHEAMGLRVQTLFLLGEPVRPQP
TWGKQGNGLAWEAAMQGDILQAAFQDSYRNLTLKTLSGLNWANKHCPMARYILKTDDDVY
VNVPELVSELVRRGGRWEQWERGTEPQSAAVVGDEEQERGGRVLGSEPVPLLYLGRVHWR
VYPSRTEGGRHQVSEQQWPMAWGPFPPYASGTGYVLSASAVQLILRVASRAPLLPLEDVF
VGVSAHRGGLTPTHCVKLAGATHYPLDRCCYGKFLLTSHRLDPRKMQQAWKLVDSPDGER
TVPFCSWLQGVLGILRCRLIAWLES
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccgcctcctccgccgcctccttctcctcgcagccttgctgctagtgattgtc
tggaccctctttgggccctcaggcctcggggaggagctgctgagcctctggctctcctcc
ctgctccccgctcctgcctcaccagcgctgcccctggccctgccccgccttctgatcccc
aacctggaagcgtgtagcgggcccggtacccctcccttcctgctcatcctggtgtgtacc
gcccctgagaatctgcaccaaaggaacgccatccgggcttcgtggggcggactgcacgag
gccatggggctgcgggtgcagaccctcttcctgctgggggagcccgtccggccacagccg
acctggggcaaacaagggaatggcctggcgtgggaggctgcgatgcaaggagacatcttg
caggcggctttccaggattcttaccgcaacctcaccctcaaaaccctcagcgggctgaac
tgggccaacaaacactgtcccatggctcgctacattctcaagacggacgatgatgtgtat
gtcaatgtccccgaactggtctcagagctggtccggcgagggggccgttgggagcaatgg
gaaaggggcacagagccccagagcgcagctgtggttggagatgaggagcaggaacggggg
ggccgggttttggggagcgagccggtgcctctgctgtacctgggtcgtgtacactggcgg
gtatatccctctaggacagaaggggggcggcaccaagtgtctgaacagcagtggcctatg
gcttggggcccctttccaccttatgcctcaggcactgggtatgtgctctcagcttctgct
gtgcagctcatcctgagggttgccagccgggcacccctcctgccactggaggatgtcttt
gtgggggtaagtgcccaccgaggaggcctcaccccaacccactgtgtcaagcttgctggt
gccacccactaccctctggaccggtgctgctatggaaaattcctgctgacatcccacagg
ttggaccccaggaagatgcaacaggcctggaagctggtggacagccctgatggagaaagg
actgtgcccttctgctcctggctccaaggagttctgggcatcctgcgatgtcggctaata
gcctggcttgagagttga

DBGET integrated database retrieval system