KEGG   Loxodonta africana (African savanna elephant): 100662543
Entry
100662543         CDS       T04351                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04137  Mitophagy - animal
lav04350  TGF-beta signaling pathway
lav04915  Estrogen signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05224  Breast cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100662543 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100662543 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100662543 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    100662543 (SP1)
   04927 Cortisol synthesis and secretion
    100662543 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662543 (SP1)
   05202 Transcriptional misregulation in cancer
    100662543 (SP1)
   05231 Choline metabolism in cancer
    100662543 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    100662543 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100662543 (SP1)
   05017 Spinocerebellar ataxia
    100662543 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100662543 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100662543 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100662543 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100662543 (SP1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100662543 (SP1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100662543 (SP1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100662543 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100662543
NCBI-ProteinID: XP_010595416
LinkDB
Position
Unknown
AA seq 777 aa
MDEMTTVVKIEKGVGGNNGGSGNGGGAFSQARSSSTGSSSSGGGGGQESQPSPLALLAAT
CSRIESPNENSNNSQGPSQSGGTGELDLAATQLSQGANGWQIISSSSGATPTSKEQSGSS
TNGGNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQL
QFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLS
GQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTAISS
ASLVSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSAGTNSQGQTPQRVSGLQGSDAL
NIQQNQTSGGSLQTSQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQ
AISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQ
GVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGASGIQVHQLP
GLPLTIANASGDHGGQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQPGRKTRREACTCPY
CKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFT
RSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDS
GAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggatgaaatgacaacagtggtgaagattgaaaaaggagttggtggcaataatgggggc
agtggtaatggtggtggtgccttttctcaggctcgcagcagcagcacaggcagtagcagc
agtggaggaggaggaggtcaggagtcccagccatcccctttggctcttttagcagcaact
tgcagcagaattgagtcacccaatgaaaacagcaacaattcccagggcccaagccagtca
gggggcacaggtgagctggaccttgcagccacacaactctcacagggtgccaatggctgg
cagattatctcttcctcctctggggctacccctacctcaaaggagcagagtggcagcagc
actaatggcggcaatggcagtgagtcttccaagaatcgcacggtttctggtgggcagtat
gttgtggctgcggcccccaatttgcagaaccagcaagtcctaacaggactgcctggggtg
atgcccaatattcagtatcaagtaatcccacagttccagaccgttgatgggcagcagctg
caatttgcagccactggggcccaagtgcagcaggatggttctggtcaaattcagatcata
ccaggtgcaaaccaacagattatcacaaatcgaggaagtggaggcaacatcattgctgct
atgccaaacctgctccagcaggctgtccccctgcaaggcctggctaataatgtgctctca
ggacagactcagtatgtgaccaatgtaccagtggccctgaatgggaacatcaccttgcta
cctgtcaacagcgtttctgcagctaccttgactcccagctctcaggcagtcacgatcagc
agctctgggtcccaggagagtggctcacagcctgtcacctcagggactgccatcagttct
gctagtctggtatcacaagccagttccagctcctttttcaccaatgccaatagctactca
acaactactaccaccagcaacatgggaattatgaactttaccaccagcggatcagcaggg
accaactctcaaggccagacaccccagagggtcagtgggctacaggggtctgatgctctg
aacatccagcagaaccagacatctggaggctcactgcaaacaagtcagcaaaaagaggga
gagcaaaaccagcagacacagcaacaacagattcttattcagcctcagctagttcaaggg
ggacaggcccttcaggcccttcaagcagcaccactgtcagggcagacctttacaactcaa
gctatctcccaggaaaccctccagaacctccagcttcaggctgttccaaactctggccct
atcatcatccggacaccaacggtggggcccaatggacaggtcagttggcagactcttcag
ctgcagaacctccaagttcagaacccacaggcccagacaatcaccttggctccaatgcag
ggtgtttccttggggcagacaagcagcagcaacaccacccttacacccattgcctcagct
gcctccatccctgctggcacagtcactgtgaatgctgcacagctctcctccatgccaggc
ctccagaccattaacctcagtgcattgggtgcttcaggaatccaggtgcaccagcttcca
ggcctgccattgactatagcaaatgcctcaggtgatcatggaggtcagcttggcctccat
ggggctggtggtgatggaatacacgatgacacagcaggtggagaagaaggagaaaacagc
ccagatccccaaccccagcctggtcggaagacccggcgggaagcatgcacctgtccctat
tgtaaagacagtgaaggaaggggctctggggaccctggcaaaaagaaacagcacatttgt
cacatccaaggttgtggcaaagtatatggcaagacctcacacctaagggcacacttgcgt
tggcacacaggcgagagaccattcatgtgtacctggtcatactgtggaaaacgcttcaca
cgctcagatgagctgcagaggcacaaacgtacacacacaggtgaaaagaaatttgcctgc
cctgagtgtcccaagcgcttcatgaggagtgaccatctgtcaaagcatatcaagacccac
cagaataagaaagggggccccggtgtagccctgagtgtgggcactttgcccctggacagt
ggggcaggttcagaaggcagtggcactgccactccttcagctcttattaccaccaatatg
gtagccatggaggccatctgtcctgagggtattgctcgtcttgccaacagtggcatcaac
gtcatgcaggtggcggatctgcagtccattaatatcagtggcaatggcttctga

DBGET integrated database retrieval system