KEGG   Loxodonta africana (African savanna elephant): 100662779
Entry
100662779         CDS       T04351                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04730  Long-term depression
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100662779 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100662779 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100662779 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100662779 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100662779 (GUCY1A2)
   04924 Renin secretion
    100662779 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100662779 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    100662779 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    100662779 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100662779 (GUCY1A2)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100662779 (GUCY1A2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Other DBs
NCBI-GeneID: 100662779
NCBI-ProteinID: XP_003415660
LinkDB
Position
Unknown
AA seq 666 aa
MHLLCTRDLNLVISINSHKRMYNEAISESLSKLPKPQTIQQTLKRTLQYYEHQVIGYRDA
EKNFHNISNRCSYADHSNKDEIEDVSGILQCTANILGLKFEEIRERFGEEFFNICFDENE
RVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPGGTFMLHYFHPHHIV
GFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDGSNPGNCSCLTFLIKECENTNTTKNPP
LGTSQVPADLRISINTFCRAFPFHLMFDPNMSVLQLGEGLRKQLRCDIHKVLKFEDCFEV
VFPKINATFERVLLRLSTPFVIRTKLEASGTENKDKVMEVKGQMIHVPESNSILFLGSPC
VDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEE
KKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISML
NELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTP
DGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINISPTTYQLL
KREESFTFIPRSREELPDNFPKEIPGTCYFLEVRTGPKQPKPSFSSSRIKKVSYNIGTMF
LRETSL
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgcacctactatgcaccagagacttgaatttagttatctcaattaattcccataaaaga
atgtataatgaagctatttcagagagtttaagtaaattgcccaagcctcagacaatacag
cagactctcaagaggacattgcagtattatgagcatcaagttattggttacagggatgca
gaaaagaatttccacaatatttctaacagatgctcctatgcagatcattccaataaagac
gaaattgaagatgtctcaggaattcttcagtgtactgctaatatactcggtttgaagttt
gaggaaattcgagaaagatttggtgaggaattctttaatatatgctttgatgagaatgag
agagttcttcgagctgtaggcggcaccttacaggacttttttaatggctttgatgctttg
ttggaacacattagaacttcttttggaaaacaggccactctggagtcaccatctttccta
tgcaaagagctccctggaggtacttttatgctccactacttccaccctcatcatattgtg
gggtttgcgatgctggggatgattaaggctgcaggaaagaagatctatcggctggatgtg
gaagtagaacaggttgccaatgagaagctgtgctcggatggttcaaacccaggcaattgt
agctgtcttaccttccttatcaaagaatgtgaaaatactaataccacaaagaaccctcca
ctgggaacatcccaagttcctgcggacctcagaattagcatcaacaccttctgcagagcc
ttccctttccatttgatgtttgaccccaacatgtcagtccttcagctgggggaaggccta
aggaagcagctccgatgtgacattcacaaagtgctcaagtttgaggactgctttgaggtc
gttttcccaaagattaatgccaccttcgaaagggtcctgctgcgactctccaccccattt
gtgattaggaccaagcttgaagcttctggcactgaaaataaagacaaggtgatggaagtc
aaaggacagatgatccatgtcccagaatcaaattccattttatttttgggctctccctgt
gtggacaagctggacgaactcatgggccgagggctgcatctctcggacatccctatccat
gatgccactcgagatgtcattttggttggtgagcaggcaaaggcccaagatggcttgaag
aagaggatggataaattaaaggcaactttagaaagaactcaccaggccctggaagaagag
aagaagaagacagtggatctcctatattccattttccctggcgatgtagcccagcagttg
tggcaagggcagcaagtgcaggccagaaagtttgatgatgtgaccatgctcttctcagac
atcgtgggtttcactgccatctgtgcccagtgtactcccatgcaggtgatcagcatgctg
aacgagctgtacacacggttcgaccaccagtgtgggtttttggatatctataaagtggaa
acaataggtgatgcatactgtgttgcagcaggactccacagaaaaagcctctgccatgcg
aaacccattgctctgatggccttgaagatgatggaactttcagaagaagtgctgacacct
gatggaagaccaattcagatgagaataggcattcactcgggctctgtgctggctggagtt
gttggggtaagaatgccgcgatattgcctgtttggaaataatgtcactctggcaagcaaa
tttgaatcgggaagtcaccctcggcgcatcaacatcagcccaaccacttaccaattatta
aaacgggaagaaagtttcacattcattcctcggtcccgtgaagagcttccagacaacttt
ccaaaggaaatccctgggacctgctatttcctggaggtaaggactggtccaaagcagcca
aagccctctttttcttcatcgaggataaaaaaggtttcctacaacattggcaccatgttc
ctccgggagacaagcctctga

KEGG   Loxodonta africana (African savanna elephant): 100663946
Entry
100663946         CDS       T04351                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3 isoform X1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04730  Long-term depression
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100663946 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100663946 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100663946 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100663946 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100663946 (GUCY1A1)
   04924 Renin secretion
    100663946 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100663946 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    100663946 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    100663946 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663946 (GUCY1A1)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100663946 (GUCY1A1)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 100663946
NCBI-ProteinID: XP_003422619
UniProt: G3TED3
LinkDB
Position
Unknown
AA seq 690 aa
MFCRKLKDLKITGECPFSVLTPGQVPKEPAEEVAGGSDSCKATPPIRQDVPEKNVQGDLP
QRKTSRSRVYLHTLAESICKLIFPEFEQLNLALQRTLAKHKIKESRKSLEREDFEKIIAD
QAIAAGVPVEIIKESLGEELFKICYEEDEQILGVVGGTLKDFLNSFSTLLKQSSHCQEAE
KRGLFDDASILCLDKDHNFLNVYYFFPKRTTSLILPGVIKAAAHILYETEVEVSLMPRCL
RNDCSEFVNQPYLLYSVHVKSTKPSLSPGKPPSSLVIPASLFCKTFPFHFMFDKDMMILQ
FGNGIRRLMSRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVIRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPSEVAQQLWQGQVVQAKKFNNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDRQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSIPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
LQGTNSKPWFQKKDNEDGNANFLGKASGID
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgttctgcaggaagctgaaggatctcaagatcacaggggagtgccctttctccgtactg
acaccagggcaggttcccaaagagccagcagaggaggtagcaggaggctcagacagctgc
aaagcaactccgcccatccgtcaggatgttcctgagaagaatgtacaaggagatcttcct
caaagaaagactagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacagctgaaccttgcacttcagagaacattggcaaaacat
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaatcattgcagac
caagcaattgcagcaggagttccagtggagatcatcaaagaatctctcggtgaagaactt
tttaaaatatgttatgaggaagatgaacagatcctaggtgtggttggaggaacccttaaa
gattttttaaatagcttcagtacccttttgaaacagagcagccattgtcaagaagcagaa
aagagaggcctgtttgatgacgcctccattctgtgcctggataaagatcacaatttccta
aacgtttactatttctttcctaagagaaccacgtccctgattcttcctggcgttattaaa
gcagctgctcacatattgtatgaaaccgaagtggaagtgtccttgatgccacgctgcctc
cgtaatgactgcagtgagtttgtcaaccagccctacttgttatactcggttcatgtcaaa
agcaccaagccatccttgtccccaggcaaacccccatcctctctggtgattccagcatca
ctcttctgtaagacatttccgttccatttcatgtttgacaaagatatgatgattctacaa
tttggcaatggtattagaaggctgatgagccggagagattttcaaggaaagcctaatttt
gaagagtactttgaaattcttacaccaaaaatcaaccaaacttttagcgggatcatgact
atgttgaatatgcaatttgttatacgagtgagaagatgggacaactccgtgaaaaaatcc
tctagggttatggaccttaaaggccaaatgatctacattgtggaatccagtgcgatcttg
ttcttggggtcaccctgtgtggacagattagaagatttcacaggacgagggctctacctt
tcagacattccaattcataacgcactgagggatgtggtcctgataggtgaacaagcccga
gctcaagatggcctgaagaagaggctggggaagctcaaggctacccttgagcaagcccac
caagccctggaggaagagaagaagaagacggtagatcttctgtgctctatatttcccagc
gaagttgctcaacagctatggcaaggacaagttgtgcaagccaagaagttcaataatgtc
accatgcttttctcagacattgttggattcactgccatctgctcccagtgctcgcccctg
caggtcatcaccatgctcaacgcactctatacccgctttgaccggcagtgtggagagctg
gacgtctacaaggtggagaccataggcgatgcatattgtgtagctggaggattacacaaa
gaaagtgatactcatgctgttcagatagcactgatggccctgaagatgatggagctctct
gatgaggtcatgtctccccatggagaacctatcaagatgcgaattggactgcactctgga
tcggtttttgccggggttgttggagttaaaatgccccgctactgtctctttggaaacaat
gtcaccctggctaacaaatttgagtcctgcagtatcccacggaaaatcaatgtcagtcca
accacttacaggttactcaaagactgtcctggttttgtgtttacccctcgatcgagagag
gagcttccaccaaacttccccagtgaaattcctggaatctgtcattttcttgatgcttat
ctacaaggaacaaattcaaagccatggttccaaaagaaagataatgaagatggcaatgcc
aattttttaggcaaagcgtcaggaatagattag

KEGG   Loxodonta africana (African savanna elephant): 100665374
Entry
100665374         CDS       T04351                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04730  Long-term depression
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100665374 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100665374 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100665374 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100665374 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100665374 (GUCY1B1)
   04924 Renin secretion
    100665374 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100665374 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    100665374 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    100665374 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100665374 (GUCY1B1)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100665374 (GUCY1B1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 100665374
NCBI-ProteinID: XP_010600205
LinkDB
Position
Unknown
AA seq 619 aa
MYGFVNHALELLVIRNYGLEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDLYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNTFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKSTETEETKQDDN
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtaatccgcaattacggcctcgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgattccaaaacttatgatttggttgctgcagcaagcaaagttctcaat
ctcaatgctggagaaatcctccaaatgtttggaaagatgttttttgtcttttgtcaagaa
tccggttatgatacaatcctgcgtgtcctgggatctaatgtcagagaatttctacagaac
cttgacgctctgcatgaccaccttgctactatctacccaggtatgcgtgcaccttccttt
aggtgcacggatgcagaaaagggcaaaggactcattctgcactactattcagagagagaa
ggacttcaggatattgtcatcggcatcattaaaaccgtagctcaacaaatacatggcact
gaaatagacatgaaggttattcaacaaagaaatgaagaatgtgaccatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttgtatgaagatcttgacagatttgaagaa
aatggtacccaggagtcacgcatcagcccatataccttctgcaaagcttttccttttcat
atcatatttgaccgggacctagtggtcacgcagtgtggcaatgccatttacagagtgctc
cctcagcttcagcctggaaattgcagccttctgtctgtcttctctctggttcgtcctcat
attgacattagtttccatgggattctctcacacatcaatacagtttttgtattgagaagc
aaggaaggattgttggatgtagagaaattagaatgtgaagatgaactgactgggactgag
atcagctgcctgcgtctcaagggtcaaatgatctacttaccagaagcagatagcatactt
tttctgtgctcaccaagtgtgatgaacctggatgatttgacaaggagaggtctgtatttg
agtgacatccctctgcatgatgccactcgagatcttgtccttctgggagaacaattccga
gaggaatacaaactgacccaggaactggaaatcctcacagacaggctgcagctcacacta
agagccctggaagatgaaaagaaaaagacagacacgttactgtattcggtccttcctcca
tccgttgccaatgagctgagacataagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctcttcagtggcattgtgggcttcaacacgttctgtagcaagcatgcatcagga
gaaggggccatgaagattgtcaaccttctcaatgacctctacaccagatttgacacactg
accgattcacggaaaaatccatttgtctacaaggtggagaccgttggtgataagtatatg
acagttagtggtttaccagagccttgcatccaccatgcacgatccatttgccacctggcc
ttggacatgatggaaatcgctggccaagttcaagtagatggtgaatctgttcagataacc
atagggatacacactggagaggtcgtgacgggtgtcatagggcagaggatgcctcgatac
tgcctttttgggaataccgttaacctcacaagcagaacagaaaccactggagagaagggg
aaaataaatgtgtccgaatatacatacagatgtcttatgacaccagaaaattcagaccca
caattccatttggagcacagagggccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctctccagaaaaagtacagaaacagaggaaacaaagcaggacgataactga

KEGG   Loxodonta africana (African savanna elephant): 100676051
Entry
100676051         CDS       T04351                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04730  Long-term depression
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100676051
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100676051
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100676051
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100676051
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100676051
   04924 Renin secretion
    100676051
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100676051
  09154 Digestive system
   04970 Salivary secretion
    100676051
  09156 Nervous system
   04730 Long-term depression
    100676051
  09159 Environmental adaptation
   04713 Circadian entrainment
    100676051
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100676051
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA Thioredoxin
Other DBs
NCBI-GeneID: 100676051
NCBI-ProteinID: XP_023406996
LinkDB
Position
Unknown
AA seq 673 aa
MTYTVYDDIITIKLIQEAQKVLGVSVEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLVEF
IENLDALHSYLALSYQEMNAPSFRVEKGADGKMLLHYYSDRSGLCHIVPGIIKAVAQDFF
DIDVNMEILDINEEEERTGKKEHIVFLVVQKTYRQMRRANPGRSQEGQDVQRDQEALETA
FLRMKEKYLSVCLCPMKKSRWDIVRSIVMFGKGHLMNTFEMVYPERLWIEEKTFCNAFPF
HIVFDESLRVKQAGVNIQKYVPGLLTQKIRVDEHFCIVHPQVTFNIFSICKFSNSQFVLK
TRRKMMPEVWKTKPMLKLRGQMIWMESMRCMVYMCSPKLRSLQELEERKMHLSDIAPHDA
TRDLILLNQQRLAEIELSNQLERKKEELRVLSKHLALEKKKTETLLYAMLPEHVANQLKE
GKKVAAGEFKTCTILFSDVVTFTSICAACEPIQIVTMLNSMYSRFDRLTSIHGVYKVETI
GDAYMVVGGVPVPVGNHAQRVANFALGMRISAREVVNPVTGEPIQVEMGIHTGPVLAGVV
GDKMPRYCLFGDTVNTASRMQSHGLPDKVHISPTAYRALENQGFEIIERGEIEVKGKGKM
TTYFLIQNLKATEDDIMGKPKIRLDHKGKQKNGRPALPISPGAQGWGLQQAGEGQGLSGS
PKSSNGFPSAVRT
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgacttacacagtgtatgatgatattatcaccattaagcttatccaagaggcccagaag
gttctgggtgtctccgtggaagccattctgaaactctttggcgaatacttctttaaattc
tgtaagatgtctggctatgacaggatgctgcggacactgggagggaatcttgtggagttt
attgaaaatctggatgccctccacagttacctcgcgctgtcttatcaggagatgaatgcg
ccatcgtttcgtgtggagaaaggagcagacgggaaaatgcttcttcattactactctgat
agaagtggtctgtgtcacattgtaccaggtatcattaaggctgtggcccaggacttcttt
gacattgatgtaaacatggaaatacttgacataaatgaagaggaggagaggacagggaaa
aaggagcacattgtgtttctggttgtgcagaagacatacagacagatgagaagagcaaat
ccaggcaggtcacaagaaggccaggacgtccagagagaccaagaggcccttgagacagct
tttcttagaatgaaggagaagtatctgagcgtatgtctttgtcccatgaagaaatctcgc
tgggatattgtgagaagcatagtcatgtttggaaaagggcatctcatgaacacctttgag
atggtttatcctgagagactctggattgaagagaaaacattctgcaatgcctttcctttc
cacattgtgtttgatgagtcgctgagggtcaagcaagccggagtgaacatccagaagtat
gtcccaggactcctaacccagaagattcgagtagacgagcatttctgcatcgttcatccc
caagttaccttcaacatcttcagcatctgcaagtttagcaacagtcaatttgtcttgaaa
acacgacgaaaaatgatgcctgaagtgtggaaaacaaagcccatgctcaaactccgaggc
cagatgatctggatggagtccatgcggtgcatggtatacatgtgctcaccgaagctgcgc
agcctgcaggagctggaggagcgcaagatgcacctttctgacatcgcaccccacgacgcc
accagggatctcatcctcctgaaccagcagcggctggctgagatcgagctgtccaaccag
ctagagaggaagaaggaggagctgcgggtcctctccaagcacctggccttagaaaagaag
aaaacggagaccttgctgtacgccatgctgcctgaacacgtggccaaccagctgaaggag
ggcaaaaaggtcgctgcaggagaatttaaaacctgcacaattcttttcagtgatgtggtg
accttcactagcatctgtgctgcctgcgaacctattcaaatagtgactatgctgaactcc
atgtactccaggtttgacaggttaaccagcatccacggtgtctacaaagtggaaaccata
ggagatgcttatatggtggttgggggcgtaccagtgcctgttggaaaccatgctcaaaga
gtggctaattttgcattggggatgagaatttctgcaagagaggtggtgaatcctgttacc
ggagagcccatccaggtagagatggggatccacactggacctgtcttagcaggcgtcgtg
ggggacaaaatgccccggtactgcttgtttggtgacactgtgaacacagcatctaggatg
caaagtcatggacttcccgacaaagtgcacatcagccccacggcctacagagccctggaa
aatcaagggtttgaaataattgagaggggcgaaattgaagtgaaaggtaaaggaaaaatg
accacatactttttgatccagaacttgaaggccacagaggatgacatcatggggaagcct
aaaatccgtctggatcacaagggtaagcaaaagaatgggagacctgcccttcccatctcc
cctggagctcagggctggggactccagcaggctggggaaggccagggactctcagggagc
cccaagtcctcaaacggcttcccaagtgccgtgagaacgtga

DBGET integrated database retrieval system