KEGG   Loxodonta africana (African savanna elephant): 100663886
Entry
100663886         CDS       T04351                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon isoform X3
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100663886 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100663886 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100663886 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100663886 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100663886 (IKBKE)
   04657 IL-17 signaling pathway
    100663886 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100663886 (IKBKE)
   05160 Hepatitis C
    100663886 (IKBKE)
   05171 Coronavirus disease - COVID-19
    100663886 (IKBKE)
   05164 Influenza A
    100663886 (IKBKE)
   05162 Measles
    100663886 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100663886 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663886 (IKBKE)
   05169 Epstein-Barr virus infection
    100663886 (IKBKE)
   05165 Human papillomavirus infection
    100663886 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100663886 (IKBKE)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100663886 (IKBKE)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100663886 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH zf-RING_9 TPR_MLP1_2 RIO1
Other DBs
NCBI-GeneID: 100663886
NCBI-ProteinID: XP_003410319
LinkDB
Position
Unknown
AA seq 721 aa
MQSTVNYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTASYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLMGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGTQRRENGPLEWSYTLPITCQLSMGLQSQLVPILANILEAEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVQHHVYIHAHNTIAIFLEAVYQQTNVAPQHQEYLFEGHLCV
LEPSLSAQHITHTTASSPLTLFSMASETPKGLAFRDPALDIPKFVPKVDLQADYNSAKGM
LGAGYQARQLAQALLEGQELMLRGLHWLVEVLQTTCRRTLEVTRTALLFLSSSLGTERFT
STAGRPEIQELSGPAELRSKLRTLAEVLSRCSQSVTETHMSLRNLSSELVKNRDQVHEDR
SIQKIQCCLDKMYLIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQ
KYQAALVTHGKRMRMVQETRNHLRLVGCSVAACNTEAQGAQESLSKILDRLSHQLLQDGR
VEAQASSPPIAPYPSPAAPGSHDLVLYMQELHREMQLLAFDLQDNNRIIERLSRVPAAPD
V
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgcagagcaccgtcaactacctctggcacacggatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatctggggagctggttgctgtgaaggtcttc
aacactgccagctacctgcgaccccgtgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacatcgtcaagctctttgctgtggaggagacggggggcagccgt
cagaaggtgctggtgatggagtattgctccagcgggagcctgctgagtgtgctcgagagc
cccgagaatgctttcgggctgcccgaggaggagttcctggtggtgctgcgttgtgtggtg
gctggcatgaaccacctgagggagaatggcatagtccaccgtgacatcaaacccggaaac
atcatgcgcctcatgggggaggaaggccagagcatctacaagctgacggactttggggct
gcgcgggagctggatgacgacgagaagttcgtctcggtctatgggactgaggagtacctg
caccccgacatgtatgagagggcggtgcttcgcaagccccagcagaaggcgtttggggtg
acggtggatctctggagcatcggggtgaccctgtaccatgcagccaccggcagcctgccc
ttcatcccctttggtgggccgaggcgcaacaaggagatcatgtaccggatcaccacggag
aaaccagctggtgccattgcaggtactcagcggcgggaaaacgggcccctggagtggagc
tacaccctccccatcacctgccagctgtccatggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggccgagcaggccaagtgctggggctttgaccagttctttgcg
gagaccagcgacatcctgcagcgcgtggttgtccatgtcttctcactgtcccaggccgtc
cagcaccatgtctacatccacgcccacaacacgattgccatctttctcgaggctgtgtac
cagcagaccaacgtggccccccaacaccaggagtacctctttgagggccacctctgtgtc
ctggagcccagcctctcagcccagcacatcacccacacgactgcaagcagccccctgacc
ctgttcagcatggccagcgagacccccaaggggctggcctttagggaccctgctctggac
atccccaagttcgtccccaaagtggacctgcaggcagattacaactcggccaagggcatg
ttgggcgctggctaccaggcccggcagctggcacaggccctgctggaggggcaggagctg
atgctccgggggctacactggctggtggaggtgctccagaccacatgtaggcggacactg
gaggtcacgcggacggccctcctcttcctcagcagcagcctgggcaccgagaggttcacc
agcacggctgggaggcctgagatccaggagctgagcgggcccgcagagctgaggtccaaa
ctgagaactttggctgaggtcctctccagatgttcgcaaagtgtcacagagacccacatg
agcctgagaaacctgagctcagagctggtgaagaaccgggatcaggtacatgaggacaga
agcatccagaagattcagtgttgtttggacaagatgtacctcatctacaaacagttcaag
aaatccaggatgagaccagggcttggctacaacgaggagcagatccacaagctggataag
gtgaatttcagtcatttagccaaaaggctcctgcaggtgttccaggaggagtgtgtacag
aagtatcaggcagccctggtcacgcacggcaagcggatgaggatggtgcaggagaccagg
aaccacctgcgcctggttggctgctccgtggccgcctgtaacactgaagcccagggggca
caggagagcctcagcaagatccttgatcggctgtctcaccagctccttcaggatggacga
gtggaggctcaggcctcatcacctcccatagccccttaccccagccctgctgcacctggt
tcccatgacctggttctctacatgcaggagcttcacagggagatgcagctgctcgcgttt
gacctccaggacaacaaccgcatcatcgaacggttaagtagggtccccgcggctcctgat
gtctga

DBGET integrated database retrieval system