KEGG   Loxodonta africana (African savanna elephant): 100664089
Entry
100664089         CDS       T04351                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein isoform X1
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100664089 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    100664089 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    100664089 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100664089 (MAVS)
   05160 Hepatitis C
    100664089 (MAVS)
   05171 Coronavirus disease - COVID-19
    100664089 (MAVS)
   05164 Influenza A
    100664089 (MAVS)
   05162 Measles
    100664089 (MAVS)
   05168 Herpes simplex virus 1 infection
    100664089 (MAVS)
   05169 Epstein-Barr virus infection
    100664089 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 100664089
NCBI-ProteinID: XP_010589851
LinkDB
Position
Unknown
AA seq 538 aa
MSAEDRTYQYIRHNHRHFFHVDVLEILPYLSCLTPSDQDRLRAYYTSRGNRDTLWDLFNC
LKRRSGWVDSLIAALRACELAGLAEEVARVYRSNLPRTTAPLEQHSVPTEVPGPAAAPSA
PYNGYREDDPSYPIPVQDTRPPEFQGERSEEALQTPSSGAVPRRPGGPQGPSSDLAALNP
LASSRHQEQDTDLGSTHTAGEVSSPTLSRGPVSPSVSFQPLARSTPRASRLPGPALSAPS
TGTSSSSTPTGLAFAGGAGDQATVTIRSSEIRVPTNPMTISTAPTEVPTNSAPTSTAPSK
LAMMPANTVPSKVPANPAFASTVPSKLPTSLKPPGTMSSNMLPSKLPTNSMRVGAVPSKV
SAGLESDPRMPTSVVPNKVPTSTVSTSKSSSRPEETPAAPAPAGPEGSSPWPDSSLETLG
PGPELSKPGELLSRVDSQPFSGSSEDLAISRSYSQDKGPSNIPEEDEYVSEFMNSFEIHV
TERPSADLLDGSPEPRAAPQPPMREELCVGEVSWLGVAAAGVLLATILTVLYRRRLLH
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgtctgctgaggacaggacctatcagtatatccgccacaatcatagacattttttccat
gttgatgttctcgagattctgccttacttgtcctgcctcacgccaagtgaccaggatcgg
ctgcgggcctactacacatccagaggaaaccgggacactctctgggacctcttcaactgc
ctgaagcggcgaagtggctgggtggattcccttatcgcggcactgagggcctgtgagctg
gctggtctcgccgaagaagtggcccgtgtctacaggagtaacctgccccggaccacagcc
ccactggagcaacattcagtccccactgaggttccagggcctgctgcggcccccagcgcc
ccctacaacggctacagagaggatgacccaagttatcccatacctgtccaggacacccgg
ccaccagaattccagggggagagatcagaggaagccctgcagacacccagctctggggct
gtcccgaggaggccaggtgggccccaggggccctcctctgacctggcggccctcaaccct
ctggcctccagcaggcatcaggagcaggacacagacctgggcagtacccacactgcaggt
gaggtctccagccccacgttatcccgtgggcctgtgtctccatccgtctccttccagccc
ctagctcgctccacccccagggcaagccgcttgcctgggcccgcactgtcagctccgtcc
actggtacctcctcctcttccacacccactggcttggcttttgcaggaggtgctggtgac
caggccacggttaccatccgctccagtgagataagggtgcccaccaaccctatgaccatc
agcacagcacccaccgaagtgcccaccaactcagcacccaccagtacagcaccctccaag
ttggccatgatgcctgcaaacacagtgccctccaaagtgcctgccaacccagcctttgcc
agcacagtgccctccaagttgcccaccagtttaaagccccctggtacgatgtcttctaac
atgctcccgtccaagttgcccaccaactcaatgcgtgttggtgcagtgccatccaaagtg
tctgctggcttggagtctgaccctaggatgcccactagtgtggtgcccaacaaggtgccc
accagcacagtgtccaccagcaagagcagcagcagaccagaggagaccccagcggctcca
gcacctgcaggccctgaaggcagctctccctggccagacagcagtttggagaccttgggc
ccagggccagagctgagcaagccaggggagctattatcccgggtagacagccagccattc
tcgggctcctccgaggacctagccatcagccgcagctactcccaggacaaggggcccagc
aacatcccagaagaggacgagtatgtgtccgagttcatgaactcctttgagatccatgtg
accgagcgccccagtgctgacctcctggatggcagccccgaacctcgtgccgccccacag
cccccaatgcgggaggagctgtgtgtcggggaggtctcctggctcggggtagctgcagct
ggggtactcctggccacgatcctgactgtgctataccggcggcgcctactgcattga

DBGET integrated database retrieval system