KEGG   Loxodonta africana (African savanna elephant): 100668973Help
Entry
100668973         CDS       T04351                                 

Gene name
ERBB3
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04151  PI3K-Akt signaling pathway
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100668973 (ERBB3)
   04012 ErbB signaling pathway
    100668973 (ERBB3)
   04020 Calcium signaling pathway
    100668973 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100668973 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100668973 (ERBB3)
   05205 Proteoglycans in cancer
    100668973 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100668973 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100668973 (ERBB3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100668973 (ERBB3)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100668973 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100668973
NCBI-ProteinID: XP_003405167
LinkDB All DBs
Position
Unknown
AA seq 1343 aa AA seqDB search
MRANGALQVLGFLLSLARGSEVGSSQAVCPGTLNGLSVTGDAENQYQTLYKLYNRCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIERNEKLCHMDTIDWRDIVRHQDAEIVVKENG
KSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCIACRHFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQAS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIEG
RSLYNRGFSLLIMKNLNITSLGLRSLREISAGRIYISANRQLCYHHSLNWTKLLRGPAEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECEPMEGAATCNGSGSDACAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPDLQDCLDQTQVPISKTHLAMALALVVGSLMIFLILG
SSFLYWRGRRIQNKRAMRRYLERGESLEPLDPREKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSERQSFQAVTDHMRAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDYVREHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELDLDLDLEGEED
NLATTLGSALSLPVGTLTRPRGSQSLLSPSSGYMPMNQGNLGEACQESAVGGGSERCPRP
ASLHPMPWRHLTSESSEGHVTGSEAELQEKASMCRSRSRSRSRSPRPCGDSAYHSQRHSL
LTPVTPLSPPGLEEEDINGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEDDEDEEYEY
MNRRRKHSPPRPPRPSSLEELGYEYMDLGSDLSASLGSTQSCPLHPVPIMPTAGTTPDED
YEYMNRRRGGGDPGGDYASMGACSAAEQGYEEMRAFRGPGYHAPNVHYTRLKTLRSLEAT
DSAFDNPDYWHSRLFPKTNAQGT
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaacggggctctgcaggtgctgggcttccttctcagcctggcccggggctcc
gaggtgggcagctcgcaggcagtatgtcccggaactctgaatggcctgagtgtgactggc
gatgccgagaaccaataccagacactgtacaagctctacaataggtgtgaggtggtgatg
gggaaccttgagattgtgctcacaggacacaatgcagatctctcattcttgcagtggatc
cgagaagtgacaggttatgtcctcgtggccatgaatgaattctctacactgccactgccc
aacctgcgagtggtacggggcacccaggtctatgatgggaagtttgccatcttcgtcatg
ttgaactataacaccaactccagccatgctctgcggcagctccgctttactcagctcact
gaaattctgtcagggggtgtttatattgagaggaacgagaaactttgtcacatggacaca
attgactggagggacatcgtgaggcaccaggacgctgaaattgtggtgaaggaaaatggc
aagagctgtcccccctgtcatgaggtctgcaaaggacgatgctggggtccaggaccagaa
gactgccagacattgaccaagaccatctgtgcccctcaatgtaatggtcactgctttggg
ccaaatcccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaagac
acagattgcattgcctgccgacacttcaatgacagtggagcctgtgtacgtcagtgtcca
cagccacttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtggccagctgtccccataacttcgtggtggatcaagcttct
tgtgtcagggcctgtcctccagacaagatggaggtagataaaaatgggctcaagatgtgc
gagccttgtggggggctgtgtcccaaagcctgtgaggggacgggctctgggagccgcttc
cagactgtggactcgagcaacatcgatggatttgtgaactgcaccaagatcctaggcaac
ctggacttcctcatcactggcctcaatggagacccctggcacaagatacctgccctggac
cctgagaaactcaatgtcttccggacagtacgggagatcaccggttacctaaacatccag
tcctggcctccccacatgcacaacttcagtgtcttttccaacctgacaaccattgagggc
agaagcctctacaaccggggcttctccttgttgatcatgaagaacttgaatatcacatct
ctgggcctccggtccctgagggaaattagtgctgggcgtatctacataagtgccaatcgg
cagctctgctatcaccattctctaaactggaccaagctgcttcgagggcctgcagaagag
agactagacatcaagcataatcggccccgcagagactgtgtggcggagggcaaagtgtgc
gacccactgtgctcctctgggggatgttggggcccaggccctggtcagtgcttatcctgc
cgaaactacagccgaggaggtgtctgcgtgacacactgcaactttctgaatggggagcct
cgtgagtttgcccatgaggctgaatgtttctcctgccacccggaatgcgaacccatggag
ggcgctgccacatgcaatggctcgggctctgatgcttgtgctcagtgtgcccattttcga
gatgggccgcactgtgtgagcagctgccctcatggagtcctaggtgccaagggtcccatc
tacaagtatccggatgttcagaatgaatgccgaccctgtcatgagaactgcacccaaggg
tgtaaaggaccagacctgcaagactgtttagaccaaactcaggtgccgatcagcaaaacc
catctggcaatggctttggcattggtagtaggatcgcttatgattttcctgatcctgggc
agtagttttctctattggcgtgggcgccggatccagaataaaagggccatgaggcgctac
ttggaacggggtgagagtttagagcctctggatcccagagagaaggctaacaaggtcttg
gccagaatcttcaaagagacagagctgaggaagcttaaagtgcttggttcaggcgtcttt
ggaactgtgcacaaaggtgtgtggatccctgagggtgaatccatcaagattccagtctgc
ataaaagtcattgaggacaagagtgaacggcagagttttcaagctgtgacagatcatatg
cgggccattggcagcctagaccacgcccacattgtacggctgctgggactgtgcccaggg
tcatcgctgcagcttgtcacacaatacttgcctctgggttccctgctggattatgtgaga
gaacaccggggggccctggggccacaactgctgcttaactggggagtacaaattgccaag
ggtatgtactaccttgaggagcatggtatggtacataggaacctggccgcccgaaacgtg
ctgctcaagtcacccagtcaagttcaggtggcagattttggggtggctgacctgctgccc
cctgatgataaacagctactacacagtgaggccaagactccaattaagtggatggccctc
gagagcatccactttgggaaatacacgcaccagagtgacgtctggagctatggtgtgaca
gtttgggagctgatgaccttcggggcagagccctatgcagggctgagactggctgaagta
ccagatctgctggagaagggggagcgattggcacagccccagatctgcaccattgatgtc
tacatggtcatggtcaagtgttggatgattgatgagaacattcgccccacctttaaagaa
ctagccaatgagttcaccaggatggcccgtgacccacccaggtatctggtcataaagaga
gagagtgggcctggaatcccccctggggcagagccccctgctctgacaaacaaggaactg
gaggaagtagagctagagccagagctagacctggacctggacttggaaggagaggaggac
aacctggcaaccacactgggttcagccctcagcctgccagttggaacactcactcggcca
cgtggaagccagagtcttctaagtccatcatctggatacatgcccatgaaccagggtaat
cttggggaggcttgccaggaatctgcagtcggtgggggtagtgagcggtgtccccgtcca
gcctccctgcacccaatgccatggcgacacctgacatcagagtcatcggagggccatgtg
acaggctctgaggctgagctccaggagaaggcatcaatgtgtaggagccggagccgaagc
cggagccggagcccacggccatgtggggacagtgcctaccattcccagcgccacagcctg
cttactcctgtcaccccactctccccaccagggctagaggaagaggatatcaatggttat
gtcatgccagatacccaccttaaaggtactccctcctcccgggaaggcaccctttcttca
gtgggtctcagttctgtcctgggtacggaagaagatgatgaagatgaagagtatgaatac
atgaaccggaggagaaagcatagtccacctcgtcctcctaggccaagttccctcgaggag
ctgggttatgagtacatggatttgggatcagacctcagtgcctcccttggcagcacacag
agttgccccctccaccctgtgcctattatgcccactgctggcacaactccagatgaagac
tatgagtatatgaaccgacgacgtggtggaggagatcctgggggggattatgcatccatg
ggggcctgttcggcagctgagcaagggtatgaagagatgagagcttttcgggggcctgga
taccatgcccccaatgtccattatacccgtctcaaaacgctccggagcttagaagccact
gactctgcctttgataaccctgattactggcatagcaggcttttccccaagaccaatgcg
cagggaacataa

DBGET integrated database retrieval system