KEGG   Loxodonta africana (African savanna elephant): 100669209
Entry
100669209         CDS       T04351                                 

Gene name
SLC2A2
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
lav04917  Prolactin signaling pathway
lav04922  Glucagon signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04950  Maturity onset diabetes of the young
lav04973  Carbohydrate digestion and absorption
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100669209 (SLC2A2)
   04922 Glucagon signaling pathway
    100669209 (SLC2A2)
   04917 Prolactin signaling pathway
    100669209 (SLC2A2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100669209 (SLC2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100669209 (SLC2A2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100669209 (SLC2A2)
   04950 Maturity onset diabetes of the young
    100669209 (SLC2A2)
   04931 Insulin resistance
    100669209 (SLC2A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100669209 (SLC2A2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100669209 (SLC2A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 OATP HlyE TraC
Other DBs
NCBI-GeneID: 100669209
NCBI-ProteinID: XP_003416315
LinkDB
Position
Unknown
AA seq 525 aa
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQIIVAHYRHVLDIPLDDRKAINNYT
INSTDEMPTIPYPMNPTPTSWDKKDSVASDGLITMLWSLSVSSFAVGGMIASFFGGWLGD
TLGRIKAMLVANSLSLIGALLMGCSKLGPSHIFVISGRAISGFYCGLISGLVPMYVGEIA
PTTLRGALGALHQLAIVLGILVSQILGLDFILGNADLWHIMLGLSAGRAILQSLLLFFCP
ESPRYLYIKLEKEVRAKKSLKKLRGCDDVTKDMIEIRKEKEEASNEQKVSIIQLFTSSSY
RQPILVALMLHMAQQFSGINGIFYYSTSIFQSAGIRQPVYATIGVGVVNTVFTALSVFLV
EKAGRRSLFLIGMTGMFFCAIFMSVGLVLLNKLTWMSYISMTAIFLFVSFFEIGPGPIPW
FMVAEFFGQGPRPAALALASFGNWACNFIIGLCFPYIEGFFGPYVFFLFAGVVLVFTLLI
FFKVPETKGKSFEEIAAEFRKKKSGSSQGPKAAVEMEFLGPPDSA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgacagaagataaggtcaccgggactttggtttttactgttatcactgctgtgttgggc
tccttccagtttggatatgacattggcgtgatcaatgcacctcaacagattatagttgcc
cattatagacacgtgctggacattccactggatgaccgaaaggctatcaacaactatact
atcaacagtactgatgaaatgcctacaattccatacccaatgaacccaacaccaacctct
tgggacaagaaagatagcgtggcatctgatggccttatcaccatgctctggtccctatct
gtgtccagttttgcagttggtggaatgatagcatccttctttggtgggtggcttggagac
acacttggaagaatcaaagctatgttggtagcaaacagtctgtcattgattggagccctg
ttgatggggtgttcaaagctgggaccatctcatatttttgtaatttcaggaagagccata
tcaggattctactgtgggctaatttcaggtctggttccaatgtacgttggtgagattgct
ccaaccacgctcaggggcgctttgggtgctcttcaccagctggccatcgtcctgggtatt
cttgttagtcagattcttggcctggactttatcttgggcaatgctgacctgtggcacata
atgcttggtctgtctgctggtagagccatcctccagtctctgctgctcttcttctgtcca
gaaagtcccagatacctttacattaagttggaaaaggaagtcagagcaaagaaaagcttg
aaaaaactcagaggatgtgatgatgtcaccaaagacatgattgagataagaaaagaaaag
gaagaagcatcaaacgagcagaaagtctccataattcagctcttcaccagttctagctat
cgacaacccattctagtagcactgatgctacacatggcccagcaattttctggaatcaac
gggatcttttactactcaaccagcatttttcagtcagctggaatcagacaacctgtttac
gcaaccattggagttggtgttgtcaacacggttttcactgctctctctgtattccttgtg
gagaaggcagggagacgctctctatttctaattggaatgactgggatgtttttctgtgcc
atcttcatgtcggtgggactcgtgttactgaataagttgacttggatgagttacataagc
atgacagccatcttcctctttgtcagtttctttgaaattggtccaggcccaatcccctgg
ttcatggtggctgagtttttcggtcaaggaccacgtcctgctgctttagcattagcctca
ttcggcaactgggcctgcaatttcatcataggtctgtgtttcccctacattgagggcttc
tttggaccttatgtgtttttcctcttcgctggagtggtgctagtctttaccttacttata
ttctttaaagttccagaaaccaaaggaaagtcctttgaagaaattgcagcagaattccga
aagaagaagagtggctcatcccaagggccaaaagctgctgtagaaatggaatttcttgga
cctccagacagtgcatga

KEGG   Loxodonta africana (African savanna elephant): 100677089
Entry
100677089         CDS       T04351                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04066  HIF-1 signaling pathway
lav04911  Insulin secretion
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav04976  Bile secretion
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05211  Renal cell carcinoma
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100677089 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100677089 (SLC2A1)
   04922 Glucagon signaling pathway
    100677089 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100677089 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100677089 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100677089 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677089 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100677089 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100677089 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100677089 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100677089 (SLC2A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100677089 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100677089 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF523
Other DBs
NCBI-GeneID: 100677089
NCBI-ProteinID: XP_010593582
LinkDB
Position
Unknown
AA seq 480 aa
MLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIQRYAEPILPTTLTTLWSLSVAIF
SVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGMSFEMLILGRFIIGVY
CGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNEELWPLLLSI
IFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMM
REKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIG
SGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAACAVLMTIALALLEQLPQMSYLSIVAI
FGFVAFFEVGPGPIPWFIVAELFSQGPRPAAVAVAGFSNWTSNFIVGMCFQYVEQLCGPY
VFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctggctgtgggaggggcagtgcttggctccctgcagtttggttacaacactggagtc
atcaatgcgccccagaaggtgatcgaggagttctacaaccagacgtggatccaacgctat
gccgagcccatcttgcccaccacgctcaccacgctctggtccctctccgtggccatcttc
tctgtggggggcatgatcggttccttctctgtgggcctctttgttaaccgctttggccgg
cggaattcgatgctgatgatgaacctgttggccttcgtctccgcggtgctcatgggattc
tctaaactgggcatgtcctttgagatgctgatcctgggccgcttcatcattggggtgtat
tgtggcctgaccacgggctttgtgcccatgtacgtgggggaggtgtcacccacggccctc
cgcggggctctgggcaccctgcatcagctgggcatcgtcgttggcattcttatcgcccag
gtgtttggcctggactccatcatgggcaacgaggagttgtggcccctgctgctgagcatc
atcttcatcccagccctgctgcagtgcatcctgctgcccttctgccccgaaagcccccgc
ttcctgctcatcaaccgcaatgaggagaaccgggccaagagtgtgctgaagaagctgcga
gggacagcagacgtgacccgtgacctgcaggagatgaaggaggagagcaggcagatgatg
cgggagaagaaggtcaccatcctggagctgttccgctcgcccgcctaccgccagcccatc
ctcatcgctgtggtgctgcagctgtcccagcagctgtcgggcatcaatgctgtcttctat
tactccacaagcatctttgagaaagcaggcgtgcagcagcctgtgtatgccaccatcggc
tccggcattgtcaacacggccttcaccgttgtctcgctgtttgtggtggagcgagccggc
cggcggaccctgcacctcatcggcctggctggcatggcggcttgtgctgtgctcatgacc
attgcgctggcactgctggagcagctgccccagatgtcctatctgagcattgtggccatc
tttggctttgtagccttctttgaagtgggccctggccccataccatggttcatcgtggct
gaactcttcagccagggtcctcgcccagctgctgttgctgttgctggcttctccaattgg
acctcaaatttcattgtgggcatgtgcttccagtatgtggagcaactgtgtggcccctat
gtcttcattatcttcactgtgctcctggtcctgttcttcatcttcacctacttcaaagtt
cctgagactaaaggccggaccttcgatgagattgcttctggattccggcaggggggagcc
agtcaaagtgacaagactccagaggagctgttccatcccctgggggctgattcccaagtg
tga

DBGET integrated database retrieval system