KEGG   Loxodonta africana (African savanna elephant): 100669448
Entry
100669448         CDS       T04351                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04144  Endocytosis
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04625  C-type lectin receptor signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100669448 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100669448 (MDM2)
   04151 PI3K-Akt signaling pathway
    100669448 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669448 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100669448 (MDM2)
   04115 p53 signaling pathway
    100669448 (MDM2)
   04218 Cellular senescence
    100669448 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100669448 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100669448 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669448 (MDM2)
   05202 Transcriptional misregulation in cancer
    100669448 (MDM2)
   05206 MicroRNAs in cancer
    100669448 (MDM2)
   05205 Proteoglycans in cancer
    100669448 (MDM2)
   05203 Viral carcinogenesis
    100669448 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100669448 (MDM2)
   05220 Chronic myeloid leukemia
    100669448 (MDM2)
   05218 Melanoma
    100669448 (MDM2)
   05219 Bladder cancer
    100669448 (MDM2)
   05215 Prostate cancer
    100669448 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100669448 (MDM2)
   05169 Epstein-Barr virus infection
    100669448 (MDM2)
   05165 Human papillomavirus infection
    100669448 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100669448 (MDM2)
   01522 Endocrine resistance
    100669448 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100669448 (MDM2)
   04121 Ubiquitin system [BR:lav04121]
    100669448 (MDM2)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100669448 (MDM2)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100669448 (MDM2)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100669448 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 100669448
NCBI-ProteinID: XP_003405637
UniProt: G3SX30
LinkDB
Position
Unknown
AA seq 492 aa
MCNTNMSVSTTDGAAASTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLG
QYIMAKRLYDEKQQHMVYCSNDLLGDLFGEPSFSVKDHRKIYTMIYRNLVVVNQQEPLDS
GTSVSENRRQLEDGKGQKDSVQELQEEKPSSSNLISRPTTSSRRRAISETEENSDELASE
GQRKRHRSDSVSLSFDESVALCVIREICCERSSSSDSTETPSNPDLDAGVSEHSGDWLDQ
DSVSDQFSVEFEVESLDSEDYNLSEEGQELSDEDDEVYRVTVYQAEESDTDSFEDDPEIS
LADYWKCTSCNEMNPPLPPHCNRCWTLRENWLPEDKRKDKEKMPESAKQENTTQVEEGFD
VPDCKKTTMNDSKESCVEENDDKIKQASHSQEGEDYSQPSTSSSIIYSSQDARESEREET
QGKDESVESRYRPIATEPCVICQDRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCR
QPIQMIVLTYFL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtgcaacaccaacatgtctgtgtctacaaccgatggtgctgctgcaagcacctcacag
attcctgcttcagaacaagagaccctggttagaccaaagccgttgcttttgaagttgttg
aagtctgttggtgcccaaaaagacacttacactatgaaagaggttatattttatcttggc
caatatattatggctaaacgattatatgatgagaaacaacaacatatggtatattgttca
aatgatcttctaggggatttgtttggtgagccaagcttctctgtgaaagaccacaggaaa
atatatacaatgatctacagaaacttggtggtagtcaatcagcaggaaccattggattct
ggcacatctgtgagtgaaaataggcgtcaacttgaggatgggaaaggtcaaaaggattct
gtgcaagagttacaggaagagaaaccttcatcttcaaatttgatttctagaccaactacc
tcatctagaaggagagcaatcagtgagacagaagaaaattcagatgaactagccagtgaa
ggacaaagaaagcgccacagatctgatagtgtttccctttcctttgatgagagcgttgca
ctgtgtgtaataagggagatctgttgtgaaagaagcagtagcagtgactcaacagaaacc
ccatcaaatccggatcttgatgctggtgtaagtgaacattctggtgattggttggaccag
gattcagtttcagatcaatttagtgtagaatttgaagttgaatctcttgattccgaagat
tataaccttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtt
actgtctatcaggcagaggagagtgatacagattcatttgaagatgaccctgaaatttcc
ttagctgactattggaagtgtacttcatgcaatgaaatgaaccctcctcttccaccacat
tgtaacagatgttggacacttcgtgagaattggcttcctgaagataaaagaaaagataaa
gagaaaatgcctgagagtgctaaacaagaaaacacaacgcaggtagaagagggctttgat
gttcctgattgtaaaaaaacaacaatgaatgactccaaagagtcatgtgttgaggaaaat
gatgataaaataaaacaagcctcccattctcaagaaggtgaggactattctcagccatca
acttccagtagcatcatttatagcagccaagatgctagagagtctgagagggaagaaact
caaggcaaagatgaaagtgtggaatctagatatcgccccattgccactgaaccatgtgtg
atttgccaagatcgacctaaaaatggttgcatcgtccacggcaaaacaggacatcttatg
gcatgctttacatgtgcaaagaagctaaaaaaaagaaataagccctgtccagtatgtaga
caaccaattcaaatgattgtgttaacttatttcctctag

DBGET integrated database retrieval system