KEGG   Loxodonta africana (African savanna elephant): 100671950
Entry
100671950         CDS       T04351                                 

Gene name
CASR
Definition
(RefSeq) extracellular calcium-sensing receptor isoform X2
  KO
K04612  calcium-sensing receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100671950 (CASR)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671950 (CASR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100671950 (CASR)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  Calcium-sensing
   100671950 (CASR)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Ephrin_rec_like AHD
Other DBs
NCBI-GeneID: 100671950
NCBI-ProteinID: XP_003413013
LinkDB
Position
Unknown
AA seq 1079 aa
MAFYSRCLILLAFAWRPAAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPVLLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIWLASEAWA
SSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCHL
QENAKGPLPVDPLLRDHKEGGSRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGKGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACDKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYVLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIAICVIWLYTAPPSSYRNHELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQEQPLALTQQEQQQPQPLTLRRQQQTQQQ
PRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSNEALTKHQALLPLQCT
EPGSELTMQDTDLQGSAGGDHQLETEGPEERAPALVVSNSRSFVISSGGSTVTENIPNS
NT seq 3240 nt   +upstreamnt  +downstreamnt
atggctttttatagccgctgcttgattctcttagcatttgcctggcgccctgctgcctat
gggcctgaccagcgagctcagaagaaaggtgacattatccttggggggctctttcccatt
cattttggagtagcagccaaagatcaagatctaaaatcaagaccggagtccgtggaatgt
atcaggtataatttccgtgggtttcgctggttacaagctatgatatttgccatagaggag
ataaacagcagcccggtccttcttcccaacatgacgcttggatacaggatattcgacacc
tgcaacactgtctctaaggccttggaggccaccctgagttttgttgcccagaataaaatc
gattctttgaaccttgatgagttctgcaattgctcggagcatatcccttctactatcgct
gtggtgggagcaactggctcgggcatctccacggccgtggcaaacttgctggggctcttc
tacatcccccaggtcagctacgcctcctccagccgactcctcagcaataagaatcagttc
aagtccttcctccgtaccatccccaatgatgaacaccaggccacagccatggcagacatc
atcgagtatttccgctggaactgggtgggcacgattgccgctgacgatgactatggccgg
ccagggattgagaagttccgagaggaggctgaagagagggacatctgcattgatttcagc
gagctcatctcccagtactcggatgaggaagagatccagcacgtagtggaggtgatccag
aattccacagccaaagtcattgttgtcttctccagtggccccgacctcgaacccctcatc
aaggagatcgtcaggcgcaatatcacgggcaggatctggctggccagtgaggcctgggcc
agctcctccttgatagccatgccggaatacttccatgtagtcggaggcactattggattt
ggcctgaaggcagggcagatcccagggttccgggaatttttgcagaaagtacatcccagg
aagtctgtccacaatggttttgccaaggagttttgggaagaaacatttaactgccacctc
caagaaaatgctaaaggacccttacctgtggaccctttactcagagatcacaaagaagga
ggcagcaggtttagcaacagctccactgccttccgacctctctgtacaggggatgagaac
atcagcagtgtcgagaccccttacatagattacacacatttacggatatcctacaatgtg
tacctggcagtctactccattgctcatgccctacaggatatatacacctgcttacctggg
aaagggctcttcaccaatggctcctgtgcagacatcaagaaagttgaggcttggcaggta
ctgaagcacctgcggcacctaaacttcaccaacaatatgggggagcaggtgactttcgat
gagtgtggtgacctggtggggaactattccatcatcaactggcacctctccccagaggac
ggctccatcgtgtttaaggaagtcgggtattacaatgtctatgccaagaagggagaaaga
ctcttcatcaacgaggagaaaatcctttggagtgggttctccagagaggtacccttctct
aactgcagccgagactgcctggcagggaccaggaaagggatcatcgagggggagcccacc
tgctgctttgagtgtgtggagtgtcctgatggggagtacagcgatgagacagatgcaagt
gcctgtgacaagtgccccgatgacttctggtccaacgagaaccacacttcctgcattgcc
aaagagattgagtttctgtcgtggacggagccttttgggatcgccctcaccctcttcgcg
gtcctgggcatcttcctgacggccttcgtgctgggggtcttcatcaagtttcgcaacaca
cccattgtcaaggccaccaaccgagagctctcctacgtcctcctcttctccctgctctgc
tgcttctccagctccctgttcttcatcggggagccccaggactggacgtgccgcctgcgc
cagccggcctttggcatcagctttgtgctctgtatctcctgcatcctggtgaaaaccaac
cgtgtcctcctggtgtttgaggccaagatccccaccagcttccaccgcaagtggtggggg
ctcaacctacagtttctgctggttttcctctgcaccttcatgcagatcgccatctgcgtc
atctggctctacaccgcgcccccctccagctaccgcaaccacgagctggaggacgagatc
atcttcatcacgtgccacgagggttcactcatggccctgggcttcctcattggctacacc
tgcctgctggctgccatctgcttcttctttgccttcaagtcccggaagctgcccgagaac
ttcaacgaagccaagttcatcactttcagcatgctcatcttcttcatcgtctggatctcc
ttcatccccgcctacgccagcacctacggcaagtttgtctcggctgtggaggtgatcgcc
atcctggcggccagcttcggcttgctggcctgcatcttcttcaacaaggtctacatcatc
ctcttcaagccttcgcggaacaccatcgaggaggtgcgctgcagcaccgctgcccacgcc
ttcaaggtggccgcccgggccaccctgcgccgtagcaacgtctcccgcaagcggtccagc
agcctcgggggctccacgggttccaccccttcgtcttccatcagcagcaagagcaacagc
gaagaccccttcccacagcccgagaggcagaagcaggagcagccactggccttgacgcag
caggagcagcagcagccccagccgttgaccctgcggcggcagcagcaaacccaacagcag
cccagatgcaagcagaaggtcatctttggcagcggcacggtcactttctcactgagcttt
gacgagcctcagaagaatgccatggcgcacaggaattccacacaccagaactccctggag
gcccagaaaagcaatgaggccctgaccaaacaccaggcgttactcccgctgcagtgtaca
gagccaggctcagaactgaccatgcaggacacagacttgcaagggtctgcaggcggggac
caccagctggagacggagggccctgaggagcgggccccagcacttgtggtgtccaattca
cggagctttgtcatcagcagcggaggcagcactgtgacagaaaacattccaaactcataa

DBGET integrated database retrieval system