KEGG   Loxodonta africana (African savanna elephant): 100673521
Entry
100673521         CDS       T04351                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1 isoform X2
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00860  Porphyrin and chlorophyll metabolism
lav01100  Metabolic pathways
lav04066  HIF-1 signaling pathway
lav04216  Ferroptosis
lav04978  Mineral absorption
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05225  Hepatocellular carcinoma
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100673521 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100673521 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100673521 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100673521 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673521 (HMOX1)
   05206 MicroRNAs in cancer
    100673521 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100673521 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673521 (HMOX1)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     100673521 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 100673521
NCBI-ProteinID: XP_003419839
UniProt: G3UAU1
LinkDB
Position
Unknown
AA seq 288 aa
MERQQPASMPQDLSEALKEATKEVHMQAENVEFMKNFQKGQVTREGFKLVMASLYHIYVA
LEEEIEHNKEHPDYAPLYFPEELHRRAALEQDMAFWYGPHWQKDIPYTGATQSYVRRLHK
VGRMEPELLVAHAYTRYLGDLSGGQLLKKIAQKALDLPSNDEGLAFFTFPNIASATKFKQ
LYRARMNTLEMSPEVRERVIEEAKTAFLLNIKLFEELQALLTQDTTDQSPSTTPRHRRQE
GSRAQESTPSKTPRGKAQLNILSQAPLLRWVLTLSFVVATVAVGLYAI
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgccagcagcccgccagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacatgcaggcagagaacgtcgagttcatgaagaactttcagaagggc
caggtgacccgagagggctttaagctggtgatggcctccttgtaccacatctacgtggcc
ttggaggaggagatcgagcacaataaggagcacccagactacgcgcccctctacttcccg
gaagagctgcaccgcagagccgccctggagcaggacatggccttctggtacgggccccac
tggcagaaggacatcccctacacaggagccactcagagctacgtgaggcggctccacaag
gtggggcgcatggagcccgagctgctggtggcccacgcctacacccgctacctaggtgac
ctctctgggggccagctcctcaagaagattgcgcagaaggctctggacctgcccagcaac
gacgagggcctggccttcttcaccttccccaacattgccagtgctaccaagttcaagcag
ctctaccgtgcccgcatgaacacgctggagatgagccccgaggtcagggagagggtcatt
gaagaggccaagaccgccttcctactcaacattaagctgtttgaggagttacaggcgctg
ctgacccaggacaccacggaccagagcccctccaccacaccaaggcatcgcaggcaggaa
ggcagccgggcgcaagagtccactccctccaagacgcccagagggaaggcacagctgaac
atcctctcccaggctccgctcctccgatgggtccttacgctcagctttgtggtggcaaca
gtggccgtggggttatatgccatctga

DBGET integrated database retrieval system