KEGG   Loxodonta africana (African savanna elephant): 100673685
Entry
100673685         CDS       T04351                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04514  Cell adhesion molecules
lav04650  Natural killer cell mediated cytotoxicity
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05143  African trypanosomiasis
lav05144  Malaria
lav05150  Staphylococcus aureus infection
lav05164  Influenza A
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05323  Rheumatoid arthritis
lav05416  Viral myocarditis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100673685 (ICAM1)
   04668 TNF signaling pathway
    100673685 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100673685 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100673685 (ICAM1)
   04670 Leukocyte transendothelial migration
    100673685 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100673685 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673685 (ICAM1)
   05416 Viral myocarditis
    100673685 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673685 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100673685 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100673685 (ICAM1)
   05164 Influenza A
    100673685 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673685 (ICAM1)
   05169 Epstein-Barr virus infection
    100673685 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100673685 (ICAM1)
   05143 African trypanosomiasis
    100673685 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100673685 (ICAM1)
   04090 CD molecules [BR:lav04090]
    100673685 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100673685 (ICAM1)
   04091 Lectins [BR:lav04091]
    100673685 (ICAM1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100673685 (ICAM1)
CD molecules [BR:lav04090]
 Proteins
  100673685 (ICAM1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Hyaluronan
  Cell surface receptors
   100673685 (ICAM1)
Lectins [BR:lav04091]
 I-type lectins (Siglecs)
  100673685 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 I-set C2-set_2
Other DBs
NCBI-GeneID: 100673685
NCBI-ProteinID: XP_023408210
LinkDB
Position
Unknown
AA seq 555 aa
MVRPPCLRAFTLEVAFAWNSHRISLDGALMGQWLRATAANHKGSGGAQVSVHPLEAIVHK
GGSVVVNCSATCNQSNIELGLETVFNKKLVSKGASWKVFELSDVQQDSSGLCYATCGDKP
EQGTATTSITMYSFPERVELAPLPPWQPVGENFTLRCQVWGGAPRANLSVVLLRGQDELS
RQLAVGEPAEVTATMPARREDYGANFSCRAELQLRGLELFKNSSTSRQLRTFALPMTHPL
LVAPHILEVGEESTTDCSLNEVFPVWEAQVHMALGDRRLSPMIKSNARALLATATVTADS
AEEGTQQLMCAVILGNQTSLETRQTVTIYSFPAPKLTLSEVEVSEWTVVTVVCEAHAAAK
VTLTGVPAPVPTPPLASRVHFDFNASAEDNGRKFFCSAALEVAGQVLYKNQTQKVNVLYG
PRLNEEDCPGNWTWQEGSEETLKCQAWGNPSPELKCLRKGDEFSLPIGDLRPVKREFAGT
YFCRAVSKRGMVTRQVVVNVLYHQNYLAVIITVAAMVKLSIGGTAGYLYNRQRKIRKYKL
QKAQEAASLKMNTPP
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggtgcggccaccctgcctcagggcctttacacttgaagttgcctttgcctggaattca
caccgcatttccttggatggagccctgatgggtcagtggttaagagctacagctgctaac
cataaagggtctggaggtgcccaagtatcagtgcaccccctagaagccatcgtgcacaaa
ggaggctccgtggtagtgaattgcagtgccacctgtaaccaatccaacatagaactgggc
ctggagacagtgttcaacaagaagctagtttctaagggggccagctggaaggtctttgaa
ctgagtgatgtgcaacaagacagtagcgggctatgctatgcaacctgtggcgataaacct
gagcagggaacagctacaacttccatcaccatgtactcgttcccagagcgcgtggagctg
gcgcccctgcccccctggcagcctgtgggcgagaacttcactctgcgctgccaggtatgg
ggcggagctccccgggccaacctctccgtggtgctgctccgcgggcaggatgaactgagc
aggcagcttgcagttggggagcctgctgaggtcacggccacgatgcctgcacgcagggag
gactacggcgccaacttctcgtgccgcgcagaactgcagctccgagggctggaactgttc
aagaacagctcgacctccaggcagctccgaacctttgccctgccaatgacccatccgctc
ctcgtggcccctcatatcttggaggtgggtgaagagtccaccacggactgctccttgaat
gaagtgttcccggtctgggaggcccaggtccacatggcactgggggaccggcgactgagc
cccatgatcaagtccaatgccagagcactcttggccacagccacggtcacggcagactca
gcagaggagggcacccaacagctgatgtgtgcggtaatcctggggaaccagacgagcctg
gagacaagacagacagtgaccatatacagcttcccggcgcccaaactgaccttgagtgaa
gtggaggtctcggaatggacagtggtgactgtggtgtgtgaggctcacgctgcagccaag
gtgacactgaccggggttccagctccagtccccaccccgcccctggcctcgagggtccat
ttcgattttaatgccagcgccgaggacaacggccgcaagttcttctgctctgctgccctg
gaggtagctgggcaggtgctgtataagaaccagacccagaaggtcaatgtcctgtatggc
ccccgactaaatgaggaggactgcccaggaaactggacatggcaggaaggctctgaggag
accctgaagtgccaggcctggggaaacccatcccccgagctgaaatgcctccgaaaaggg
gatgagttctcactgcccattggggacctgaggcctgtcaaacgggagtttgcaggcacc
tacttctgccgggccgtgagcaagcgtggcatggtcacccgccaagtggttgtgaacgtg
ctctaccaccagaactacttggctgtcatcattacggtggcagccatggtcaaactaagc
atcggaggcacagccggctacctctataaccgccagcggaagatcaggaaatacaagtta
cagaaggctcaggaggcggcctccctgaagatgaacacaccaccctga

DBGET integrated database retrieval system