KEGG   Loxodonta africana (African savanna elephant): 100674125
Entry
100674125         CDS       T04351                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04151  PI3K-Akt signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav05162  Measles
lav05165  Human papillomavirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100674125 (CDKN1B)
   04066 HIF-1 signaling pathway
    100674125 (CDKN1B)
   04068 FoxO signaling pathway
    100674125 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100674125 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100674125 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674125 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100674125 (CDKN1B)
   05206 MicroRNAs in cancer
    100674125 (CDKN1B)
   05203 Viral carcinogenesis
    100674125 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100674125 (CDKN1B)
   05220 Chronic myeloid leukemia
    100674125 (CDKN1B)
   05215 Prostate cancer
    100674125 (CDKN1B)
   05222 Small cell lung cancer
    100674125 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100674125 (CDKN1B)
   04934 Cushing syndrome
    100674125 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100674125 (CDKN1B)
   05169 Epstein-Barr virus infection
    100674125 (CDKN1B)
   05165 Human papillomavirus infection
    100674125 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100674125 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100674125
NCBI-ProteinID: XP_003405705
UniProt: G3UH31
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEMEKGSLPEFYYRPPRPPKGACKVPAQESQDVNGSRQAVPLIG
SQANSEDTHLVDQKTETSDSQTGLAEQCPGIRKRPATDDSSTQNKRANRTEENVSEGSPN
AGSVEQTPKKPSLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccctaagccctccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ttaactcgggacttggagaagcactgcagagacatggaagaggctagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggaggggaaatacgagtggcaagagatggaa
aagggcagcttgcccgagttttactacagacccccgcggccccccaaaggcgcatgcaag
gtgccggcgcaagagagccaggatgtcaacgggagccgtcaggcggtgcctttaataggg
tctcaggcaaactcagaggacacacatttggtagaccaaaagactgaaacatcagacagc
cagacggggttagcggagcagtgccctgggatacggaagagacctgcaacagacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagaagggtccccaaac
gcaggctcagtggagcagacgcccaagaagccgagcctcagaagacgtcaaacataa

DBGET integrated database retrieval system