KEGG   Loxodonta africana (African savanna elephant): 100676682
Entry
100676682         CDS       T04351                                 

Gene name
AQP4
Definition
(RefSeq) aquaporin-4 isoform X1
  KO
K09866  aquaporin-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100676682 (AQP4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100676682 (AQP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100676682 (AQP4)
Transporters [BR:lav02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    100676682 (AQP4)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 100676682
NCBI-ProteinID: XP_003406394
UniProt: G3SXM7
LinkDB
Position
Unknown
AA seq 323 aa
MSGRPAARRWGKCGPLCRREDIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
GNEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTKKISIAKSVFYIA
AQCLGAIIGAGILYLVTPRSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAAGLYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVH
VIDIDRGEEKKGKDPSGEVLSSV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtggcagacccgcagcaagaaggtggggtaagtgtggacctctgtgtagaagagaa
gacatcatggtggcctttaaaggggtctggactcaagctttctggaaagctgtcacagca
gaattcctggctatgcttatttttgttctcctcagcctgggatccaccatcaactggggt
ggaaacgaaaaacccttacctgtagacatggtccttatctccctttgctttggactcagc
attgccaccatggtgcagtgctttggccacatctccggtggccacatcaacccagctgtg
accgtggccatggtgtgcaccaagaagatcagcatcgccaagtctgtcttctacatcgca
gcccagtgcctgggggccatcattggagcaggaattctttaccttgtcacgccccgcagc
gtagtgggaggcttgggagttaccacggttcatggaaatcttactgctggtcacggtctc
ctggtggagctgataatcacatttcagttggtgtttactatttttgccagctgtgattcc
aaaaggactgatgtcactggttcaatagctttagcaattggattttctgtcgcaattgga
catttgtttgcaattaactatactggtgccagcatgaaccctgcccgatcctttggacct
gcagttatcatgggaaattgggaaaaccattggatatattgggttggaccaataatagga
gctgtccttgctgctggcctttatgagtacgtcttctgtccagatgttgaactcaaacgt
cgtcttaaagaagccttcagcaaagctgcccaacaaacaaaagggagctacatggaggtg
gaggacaacaggagtcaggtagagactgaagacttgattctaaagcctggagtagtacac
gtgattgacattgaccgaggagaggagaagaaggggaaagacccatctggagaggtgtta
tcttcagtatga

DBGET integrated database retrieval system