KEGG   Loxodonta africana (African savanna elephant): 104846102
Entry
104846102         CDS       T04351                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04650  Natural killer cell mediated cytotoxicity
lav05132  Salmonella infection
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104846102
   04061 Viral protein interaction with cytokine and cytokine receptor
    104846102
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104846102
   04217 Necroptosis
    104846102
   04115 p53 signaling pathway
    104846102
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104846102
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104846102
  09172 Infectious disease: viral
   05164 Influenza A
    104846102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    104846102
   04090 CD molecules [BR:lav04090]
    104846102
Cytokine receptors [BR:lav04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   104846102
CD molecules [BR:lav04090]
 Proteins
  104846102
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 104846102
NCBI-ProteinID: XP_010590676
LinkDB
Position
Unknown
AA seq 437 aa
MSWGARPPLHSSGNALGSHKILIFVALGALLLVPADLAAVNLQDGKIAAPQQRIPRSLEG
FCKPGYHVSIDSEDCISCQYGVGYTNHSNILSSCLPCTVCKADEDEISPCTLTRDTECQC
KAGTFLERDAPEICQKCSTGCPDGKVQYSPCTPWSDLKCVPREEGTKATGEAMVSGEPVT
TGLKTPTTASPSSGFRYHAIWISVVILVPLALLVFLRRRILQGCGMASKYVNRVLFWRLC
SQEGPGTHDNAQNEALSNRLDPELEEEGQEQTEVTGDRGQTPVEAEALQGNAEGSQMRRV
PLVVVNGADPAETLRSFFDYFIKEVPLASWKAVMRQMGLTDNEMEMARASETDITEQHYK
MLVQWHQKTGKDASVNTLLDALETQGQRNARERIQDYLLLSGKYTYAESRTATNDMCVCT
GMKELLHDPLQTPAWNK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtcgtggggagccaggcctccgctacacagctccgggaatgcgctcggcagccacaag
atccttatcttcgtcgccttgggtgcattgctactggtcccagctgacttggctgcagtc
aacctgcaggacgggaaaatagctgccccacagcaaaggatccccagatcactggagggg
ttttgcaaaccaggttaccatgtttccatagactctgaagattgtatctcgtgccagtat
ggagtgggttacaccaaccattcgaacatcttatcttcctgcttaccttgtacagtttgt
aaagcagatgaagacgagataagtccatgcaccctcaccagagacacagagtgtcaatgc
aaggctggcaccttccttgaaagagatgcccctgagatctgccagaagtgcagcactggg
tgcccggatgggaaagttcagtatagtccctgtaccccctggagtgacctgaagtgtgtc
cccagagaagaaggtaccaaagccactggggaagccatggtttctggagagccagtaacc
actggcctgaagactcccactactgcctctccttcctcaggctttagataccatgcgatc
tggatctcagtggttatattggtgcccctggcccttctggtatttcttcggaggcgcatt
cttcaaggttgtggaatggcctccaaatacgtaaacagagtcttgttctggcggctgtgc
tcccaagaagggcctgggactcatgacaatgctcaaaatgaggccctgagcaacagactg
gaccctgagctggaagaggaaggccaggagcagactgaggtgacaggtgacaggggacag
accccagtggaagcagaggctctccagggtaatgctgaagggtctcagatgagaagggtg
ccgctggttgtagtgaatggtgcagaccccgctgaaactctaaggtcattctttgattac
ttcataaaagaagtgcccttagcttcctggaaggcagtcatgcggcagatgggcctcaca
gacaatgagatggaaatggccagagccagtgaaacagatatcaccgaacagcactacaaa
atgctggtccagtggcaccaaaagacagggaaggatgcctctgtgaacaccctgctggat
gccttggaaacacaaggacaaagaaatgcaagagagagaattcaggactacctgttgctc
tccggaaagtacacctacgcagaatccaggacagccaccaatgatatgtgtgtgtgtaca
ggaatgaaagaattgcttcatgacccacttcagacaccagcctggaataaatag

KEGG   Loxodonta africana (African savanna elephant): 104846103
Entry
104846103         CDS       T04351                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04650  Natural killer cell mediated cytotoxicity
lav05132  Salmonella infection
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104846103
   04061 Viral protein interaction with cytokine and cytokine receptor
    104846103
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104846103
   04217 Necroptosis
    104846103
   04115 p53 signaling pathway
    104846103
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104846103
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104846103
  09172 Infectious disease: viral
   05164 Influenza A
    104846103
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    104846103
   04090 CD molecules [BR:lav04090]
    104846103
Cytokine receptors [BR:lav04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   104846103
CD molecules [BR:lav04090]
 Proteins
  104846103
SSDB
Motif
Pfam: Death TNFR_c6 DUF5665 DUF5706
Other DBs
NCBI-GeneID: 104846103
NCBI-ProteinID: XP_010590678
LinkDB
Position
Unknown
AA seq 396 aa
MLLFIAFCVLMPVPADSAPANHQYSVYSLTAARQQSPSEEVCGAGFRVSEVRGTRKCISC
TRGVNFSNHSNAPFCLLCSVCKPDEDEISPCTLTRDTECQCKAGTFLERDAPEICQKCST
GCPDGKVQYSPCTPWSDLKCVPREEGTKATGEAMVSGEPVTTDLKTPTTASPSSGFGIWI
GITVVVFLLLAVLAVILSCIPQGCGMASKYINRVLFWWLCSQEGPGTHDNAQNEALSNRL
DPELGEEGQEQTEVTGDRGQTPVEAEPLQVCQNAEESQRGWKPLVPVNGTDPTETLRSFF
DYFIKEVPFASWKAVMRQMGLRDNEMEMARASETDIKEQCYKMLVQWLQKTGKDASVNTL
LDALEAQEQRNARERIQNSLVLSGKYTYKEDRPDTQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcttctcttcatcgccttctgtgtcctgatgccggtcccagctgactcagccccagcc
aaccatcagtacagtgtttacagtctaacagctgcccgacagcaaagcccttcggaggaa
gtttgtggagcaggtttccgtgtttcagaggtgagaggtactagaaaatgtatctcatgc
acacgtggagtgaatttcagcaatcattcgaacgcccctttctgcttactctgtagtgtt
tgcaaaccagatgaagacgagataagtccatgcaccctcaccagagacacggagtgtcaa
tgcaaggctggcaccttccttgaaagagatgcccctgagatctgccagaagtgcagcact
gggtgcccagatgggaaagttcagtatagtccctgtaccccctggagtgacctgaagtgt
gtccccagagaagaaggtaccaaagccactggggaagccatggtttctggagagccagta
accactgacctgaagactcccactactgcctctccttcctcaggctttgggatctggatc
gggatcacagtggttgtattcttgctcctggccgttctggcagttattttgtcgtgcatt
cctcaaggttgtggaatggcctccaaatacataaacagagtcttgttctggtggctgtgc
tcccaagaagggcctgggactcatgacaatgctcaaaatgaggccctgagcaacaggctg
gaccctgagctgggagaggaaggccaggagcagactgaggtgacaggtgacaggggacag
accccagtggaagcagagcctctccaggtttgccaaaatgctgaagagtctcagagggga
tggaagcctctggttccagtgaatggtacagaccccactgaaactctaaggtcattcttt
gattacttcataaaagaagtgccctttgcttcctggaaggcagtcatgcggcagatgggc
ctcagagacaatgagatggaaatggccagagccagtgaaacagatatcaaagaacagtgc
tacaaaatgctggtccagtggctccaaaagacagggaaggatgcctctgtcaacaccctg
ctggatgccttggaagcacaagaacaaagaaatgcaagagagagaattcagaacagcctg
gtgctctccggaaagtacacttataaagaagacaggccagacacccaatga

DBGET integrated database retrieval system