KEGG   Latimeria chalumnae (coelacanth): 102347870
Entry
102347870         CDS       T02913                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102347870 (IGFBP3)
   04218 Cellular senescence
    102347870 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102347870 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102347870 (IGFBP3)
Membrane trafficking [BR:lcm04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    102347870 (IGFBP3)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102347870 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP BLOC1_2
Other DBs
NCBI-GeneID: 102347870
NCBI-ProteinID: XP_006013829
Ensembl: ENSLACG00000001655
UniProt: H2ZWT5
LinkDB
Position
Un
AA seq 278 aa
MVWRLCVLCLAAVLALLSRLAEAVGPVVRCEPCDSRALEQCKPLAAGCEEAVREPGCGCC
LTCALTEGQACGVYTERCGSGLSCQHRTGELRPLHALLEGRGVCTSATTTKVQTLLLPSY
LPGNSSDSEEERNASSIENQAIPNTQRVLDSKLHPHHTKLEIIQKEQAKNTQRYKQYEPI
STDAQNLSSELKQDTEYGPCRRELDGILNNLKIMNVVSPRGLRIPNCDKKGFYKKKQCRP
AKGRKRGFCWCVDKYGQPLPGYDGKGKGDVHCYNLESK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtttggagactctgcgtgctgtgtctggctgcggtgttggcgctgctgagccggctg
gcggaggcggtgggtccagtggtccggtgcgagccctgcgactccagggcgctggagcag
tgcaagccactggctgcgggctgcgaggaggcggtgcgggagcccggctgcggctgctgc
ctgacgtgcgcgctcaccgagggacaggcgtgcggggtctacaccgagcgctgcggctct
gggctcagctgtcaacaccgaaccggggagttgagaccactgcatgcgctactagagggc
aggggggtctgcaccagcgccacgacaaccaaagttcagactttactgctgccatcatat
cttccaggaaacagcagtgattccgaagaagagagaaatgccagcagcattgagaaccag
gccattcctaatacacaaagagtgctagattccaaattgcatccacaccataccaaatta
gagatcatccagaaagaacaagccaaaaatacccagcggtacaaacaatacgagccaata
agcacagatgcacaaaacctttcttcagaattaaaacaagacactgaatatggaccctgc
cgtagggaactggatggcatattaaataacctaaagatcatgaatgtagtgagtccaaga
ggactacgcattccaaattgcgataagaaaggcttctacaagaaaaagcagtgtcgtcca
gccaaaggcaggaaaaggggtttctgctggtgcgtggataaatatggacagcctctgcct
ggctacgatgggaaaggaaagggagatgtgcactgttataacttggagagtaagtga

DBGET integrated database retrieval system