KEGG   Latimeria chalumnae (coelacanth): 102358103
Entry
102358103         CDS       T02913                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04145  Phagosome
lcm04350  TGF-beta signaling pathway
lcm04510  Focal adhesion
lcm04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102358103 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102358103 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102358103 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102358103 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102358103 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102358103 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lcm00536]
    102358103 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:lcm04990]
    102358103 (THBS1)
Membrane trafficking [BR:lcm04131]
 Endocytosis
  Phagocytosis
   Opsonins
    102358103 (THBS1)
Glycosaminoglycan binding proteins [BR:lcm00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   102358103 (THBS1)
Domain-containing proteins not elsewhere classified [BR:lcm04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   102358103 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 TSP1_ADAMTS cEGF TSP1_CCN EGF_CA EGF Laminin_G_2 Laminin_G_3
Other DBs
NCBI-GeneID: 102358103
NCBI-ProteinID: XP_005988414
Ensembl: ENSLACG00000018199
UniProt: H3BFP1
LinkDB
Position
Un
AA seq 1170 aa
MKLPQGVFLLIMLVGLCGASRSLESGGDDNGVYDLFEITKATRKYYGVNLITGPDPSSPT
YKILNVDRIPPVPESIFLELLDQIQTERGFLLLATLKQLKGTRGSLLAVENQDQPGHVFD
ILSNGKAGTLDLTFTVDGKQHVVSLEEAKLATAHWKNITLFVQEDRAQLYVGCDKIENVE
LEAPIQKILHPSIASTTRLRLAKGNVKENNFQGSLSNVRFVFGTTLEAILRNKGCSSFST
ETIKLDNPVNGSSPAIRSNYIGHKIKNVCGFTCDELTEMFKEMKGLQSVITQLVEDLNNM
RQLNEMTGGRIGISQGTCIYKGNVHRENEEWTVDNCMECSCKNSATFCSKVSCPLVSCAN
ATVPDGECCPRCLPNDSAEDSWSPWSEWTPCSVSCGIGTQQRGRSCDRINNICLGPSVQT
RTCHIQECDKRFRQDGGWSYWSPWSSCSVTCGIGVKTRIRLCNSPTPQMGGRQCEGEGRE
TQECQKDPCPINGNWGPWSPWNTCTVTCGGGIQKHSRLCDSPMPKYGGKECVGEATATQI
CNKEDCPIDGCLSNPCFAGTKCTSFPDGSWKCGACPAGYQGNGVQCEDIDECKEVPDTCF
VFNGVHRCENTEPGYNCLPCPPRFNGLQPYGRGVEEATGNKQVCKPRNPCTDGTHNCNKH
ARCIYLGHYSDPMFRCECRPGYAGNGIICGEDTDLDGWPNQDLLCVANATYHCTKDNCPT
LPNSGQEDYDKDGIGDACDKDDDDDGIPDERDNCPLIFNPQQYDYDRDDVGDRCDNCPYN
HNPDQTDTDANGEGDACAKDIDGDGIPNERDNCPYVYNVNQKDTDWDGVGDQCDNCPLEN
NPDQTDSDSDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLAFNPDQLDSDGDGRGDACKDDFDQDNVPDIYDVCPENFEISETDFRRF
QMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQITQTYWDTTPTKAQGYSGLSIKVVNSTTGPGEHLRNAL
WHTGHTAGQVRTLWHDPRHTGWKDFTAYRWHLTHRPKTGYIRVVMYEGKKIMADSGAIYD
KTYAGGRLGLFVFSQEMVYFSDLKYECRDT
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgaagttacctcaaggagtatttctactcataatgttagtaggactctgtggagccagc
aggagcctagaatcaggtggagatgacaatggcgtttatgacctctttgaaatcacaaag
gctacacgcaaatattacggggtgaacttaattacaggtcctgacccttcaagcccaaca
tataagatccttaacgtagacaggatccccccagtgccagagtccatattcctagagttg
cttgatcagatccagactgaacggggcttcctcctcctggccaccctcaagcagctcaag
gggacccggggcagcctgctggcagtggaaaaccaggaccaacctgggcacgtcttcgac
atcttgtcaaacggtaaagctggaaccctcgatctcaccttcaccgtggacggcaagcag
catgtggtgtccctggaggaagccaagctggccacggcccactggaagaacatcaccctt
ttcgtgcaagaggacagagctcagctgtacgtgggctgtgacaagatcgagaacgtcgag
ctggaagcccccatccagaagatcctccaccccagcatcgccagcaccaccaggctcaga
ctggccaaaggaaatgtcaaagaaaacaactttcaggggtcgctctcgaacgtgcgattt
gtctttggaacaactttggaagcgatcctccggaacaagggctgctccagcttttccacc
gaaaccattaaactggacaacccagtgaatggctccagccctgcaatcagaagcaactac
attggtcataaaataaagaatgtctgtggcttcacctgcgatgagctgactgaaatgttc
aaggagatgaagggactccagtctgtgatcacccaactagtggaggacctcaacaacatg
aggcaattaaatgaaatgactgggggacggattggaatcagtcagggcacgtgcatttac
aaagggaatgttcacagagaaaatgaggaatggactgtggacaactgcatggaatgtagc
tgcaagaactcagcaacattttgcagtaaagtgtcctgcccccttgtgtcctgtgctaat
gccactgttccagatggagagtgctgcccacgatgcttgcccaatgactcagcagaagac
agctggtccccctggtcagaatggaccccctgttcagtttcctgcggaatcggcactcag
cagcggggccgatcctgtgaccgcattaacaatatctgtttgggcccctctgttcaaact
cgtacctgccacattcaggaatgcgacaagcgatttagacaagatggtggctggagttac
tggtccccatggtcctcctgctcagtgacctgtggcataggagtcaaaaccagaatccgt
ctctgcaactctcccaccccacagatgggtggccggcaatgtgagggagaaggcagagag
acacaggagtgccagaaggacccctgtcccattaatggaaactggggaccctggtcacca
tggaacacctgcactgtcacctgtggagggggcattcaaaaacacagtcgcctctgcgac
agccccatgcccaagtacggtgggaaagagtgtgttggggaggccaccgcaacccaaatc
tgtaacaaggaggactgtccaatcgatgggtgcctgtccaatccctgctttgctggaacc
aaatgcaccagtttccctgatggctcctggaagtgtggggcctgtccagctggttaccaa
ggaaatggtgttcaatgcgaagatattgatgagtgcaaagaggtgccagatacatgcttt
gtcttcaatggagtgcacagatgtgaaaacacagaacctggatataactgtctgccctgc
ccaccacgttttaatggattacagccctatggacgtggtgtggaagaggccacaggcaac
aaacaggtctgcaagcctcgcaacccttgcactgatgggactcacaactgtaacaagcac
gcccgctgcatctacctgggccactacagcgaccccatgttccgctgcgagtgcaggcca
ggctatgctggtaacggcatcatctgcggagaggacactgacctggatggctggcccaac
caagatctgctctgtgtggccaacgctacctaccactgcacgaaagacaactgccccact
ctgccaaattctggccaggaagactacgataaggatggaattggtgatgcctgtgacaag
gatgacgatgatgatggcattcctgatgaaagggacaactgcccgcttatcttcaaccca
cagcagtacgactatgaccgggatgatgtgggagatcgttgtgacaactgcccatacaac
cacaaccccgatcagacagacaccgatgccaatggagagggagatgcctgcgctaaagat
attgatggggatggtattccaaatgagagagataactgcccctacgtatacaatgttaac
cagaaggataccgactgggatggagtcggagaccagtgtgacaactgtcctttggagaac
aacccagaccagactgattctgactctgatcgtgttggagacaagtgtgacagcaaccaa
gatatagatgaagatggtcatcagaacaacctggataactgcccatacatccccaatgcc
aaccaggccgaccacgacaaggatggcaagggtgatgcctgtgaccatgatgatgataat
gatggtatccctgatgataaagacaactgcagactggcctttaaccctgaccagctcgat
tcagatggtgatggacgtggtgatgcctgtaaagatgactttgatcaggacaatgtacca
gatatctatgacgtctgtcctgagaactttgaaatcagtgaaactgacttccgcagattc
cagatggtgccccttgatcccaaaggcacatctcagattgatcccaactgggtggtgcgt
caccagggcaaagagctggtccagacagtcaactgcgaccctggcattgcagtcggatat
gatgagttcaatgctgtggactttagcggcaccttctttatcaacacggaacgtgatgat
gattatgctggttttgtcttcggctaccagtccagcagccgcttctatgtagtcatgtgg
aaacagatcacacagacctactgggatacaacaccaaccaaagcacagggctactcagga
ctgtccatcaaagtggtcaactccaccaccggccctggggagcacttacgtaatgccctg
tggcacactggacatacagcaggacaggttcgcactctatggcacgatcctcgtcacaca
ggctggaaagactttaccgcttacagatggcaccttacccacagaccaaagactggctac
attagagttgtaatgtatgaagggaagaagatcatggctgactcgggtgccatctatgac
aagacctatgctggaggtcggttaggtctcttcgtcttctctcaagaaatggtttacttt
tcagatctcaagtatgagtgcagagatacataa

DBGET integrated database retrieval system